CAZyme Information: MGYG000000029_03080

Basic Information

• Species: Bacteroides finegoldii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides finegoldii
• CAZyme ID: MGYG000000029_03080
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
779		88877.05	8.1489

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000029	4415875	Isolate	United Kingdom	Europe

• Gene Location: Start: 11444; End: 13783 Strand: -

Full Sequence      

MKNRLIALLVLFTVTFFVSSAQAQTTARKFEAGKNTFLLDGKPFVVKAAELHYTRIPQAY
WEHRIEMCKALGMNTICIYIFWNIHEQEEGKFDFTGQNDIAAFCRAAQKHGMYVIVRPGP
YVCAEWEMGGLPWWLLKKRDIALRTLDPYYMERVGIFMKEVGKQLAPLQVNKGGNIIMVQ
VENEYGSYGINKPYVSAVRDLVRESGFTDVPLFQCDWSSNFTNNALDDLIWTVNFGTGAN
IDQQFKKLKELRPETPLMCSEFWSGWFDHWGRKHETRPAKDMVQGIKDMLDRNISFSLYM
THGGTTFGHWGGANNPAYSAMCSSYDYDAPISEAGWTTEKYFLLRDLLKNYLPAGAALPE
VPAALPVIEIPEFHFTKVAPLFSNLPEAKHSTDIQPMEQFNQGWGTILYRTTLPEAVAVG
TVLKITEVHDWAQVYADGKLLARLDRRKGEFTTTLPILKKGTQLDILIEAMGRVNFDKSI
HDRKGITEKVELISGNQTKELKNWTVYNFPVDYSFIKDKKYNETKQLPTMPAYYKGTFKL
DKVGDTFLDMSTWGKGMVWVNGHAMGRFWKIGPQQTLFMPGCWLKKGENEILVLDLKGPA
KASIKGLKKPILDVLREKAPETHRKDGEKLKLTGEKAVCEGAFTPGNGWQEVRFDTPVKG
RYFCLEALSPQANDNIAAVAEFDVLGADGKPVSREHWKIRYADSEETRSGNRTADKIFDL
QESTFWMTVDNVAYPHHLVIDLSKVETVTGFRYLPRAEKNYPGMIREYRVYVRPVDFNY

Enzyme Prediction     

No EC number prediction in MGYG000000029_03080.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	37	349	3.8e-119	0.993485342019544

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	1.27e-171	36	349	1	316	Glycosyl hydrolases family 35.
PLN03059	PLN03059	7.99e-51	1	349	2	340	beta-galactosidase; Provisional
COG1874	GanA	1.06e-47	36	606	7	600	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02449	Glyco_hydro_42	3.90e-10	57	186	8	139	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
pfam00754	F5_F8_type_C	5.51e-07	702	772	2	70	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU94062.1	0.0	1	779	1	778
ALJ48378.1	0.0	1	779	1	778
QRQ55220.1	0.0	1	779	1	778
SCV07788.1	0.0	1	779	1	778
QUT78556.1	0.0	1	779	1	778

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EON_A	0.0	1	777	1	777	GalactanaseBT0290 [Bacteroides thetaiotaomicron VPI-5482]
3D3A_A	5.37e-315	30	628	8	605	Crystalstructure of a beta-galactosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4MAD_A	1.20e-146	35	596	22	578	ChainA, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
3WF3_A	5.02e-122	26	597	29	623	Crystalstructure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_B Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_C Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_D Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF4_A Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_B Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_C Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_D Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens]
3THC_A	5.07e-122	26	597	5	599	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48982	9.09e-128	37	579	37	573	Beta-galactosidase OS=Xanthomonas manihotis OX=43353 GN=bga PE=1 SV=1
Q58D55	1.92e-121	6	624	5	650	Beta-galactosidase OS=Bos taurus OX=9913 GN=GLB1 PE=2 SV=1
P16278	5.28e-121	26	597	28	622	Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1 PE=1 SV=2
Q60HF6	1.68e-120	26	612	28	644	Beta-galactosidase OS=Macaca fascicularis OX=9541 GN=GLB1 PE=2 SV=1
P23780	4.86e-120	29	597	34	624	Beta-galactosidase OS=Mus musculus OX=10090 GN=Glb1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000228	0.999156	0.000151	0.000168	0.000150	0.000134

TMHMM  Annotations     

start	end
5	27