CAZyme Information: MGYG000000030_00140

Basic Information

• Species: CAG-603 sp900066105
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-603; CAG-603 sp900066105
• CAZyme ID: MGYG000000030_00140
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
260	MGYG000000030_1|CGC1	30648.47	9.3121

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000030	3025033	Isolate	United Kingdom	Europe

• Gene Location: Start: 145985; End: 146767 Strand: +

Full Sequence      

MQHTFAICAYKESPYLEECIESLMAQEMKSEIIICTSTPNDYIKNMAEKYNIKLYINTGK
SGITEDWNFAYSKTTTKYVTIAHQDDVYLPLYSKTMSDMMEKAKNPIIFFTDYYELRNGK
KVHNTGLLKIKRLMLAPLKIKIFQRSKFIRRRILSMGSPICCPSVTFNKERFREPLFKNH
FRTNEDWECWEILSRHKGTFVYSSTPLTCHRIHEGSETSAAIAETGRSSEDYEMFRKFWP
KFIAKLLVKQYGKSEKYNEL

Enzyme Prediction     

No EC number prediction in MGYG000000030_00140.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00761	Glyco_tranf_GTA_type	5.50e-12	7	108	3	110	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd04196	GT_2_like_d	6.86e-11	6	220	3	212	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	5.62e-10	4	152	1	161	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd04195	GT2_AmsE_like	2.66e-08	10	190	8	180	GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis. AmsE is a glycosyltransferase involved in exopolysaccharide amylovora biosynthesis in Erwinia amylovora. Amylovara is one of the three exopolysaccharide produced by E. amylovora. Amylovara-deficient mutants are non-pathogenic. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
COG0463	WcaA	1.70e-07	7	250	9	246	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW77440.1	4.64e-111	2	260	8	266
QIB58008.1	4.64e-111	2	260	8	266
ASU27515.1	9.35e-111	2	260	8	266
ANU74711.1	9.35e-111	2	260	8	266
QQQ92258.1	9.35e-111	2	260	8	266

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000030_00140.