CAZyme Information: MGYG000000031_02079

Basic Information

• Species: Blautia_A sp900066205
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp900066205
• CAZyme ID: MGYG000000031_02079
• CAZy Family: GH1
• CAZyme Description: Beta-glucosidase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
248	MGYG000000031_6|CGC2	29553.61	5.0821

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000031	3671868	Isolate	United Kingdom	Europe

• Gene Location: Start: 39371; End: 40117 Strand: -

Full Sequence      

MLRQYGKQKLIIGYAPTCGMCYPETEKPEDIEAARQMMFSLQPDDSNWTWNIPWWSDPVL
LGHYPEEGLERYAKYLPKITDEDMKLISEPIDIYGQNIYNGRCIRMGKDGKPEEVKRYDG
FPKTAIDWPVTPEVLYWEPKFLYERYQKSIYITENGMSCHDVVSLDGKVHDPNRIDFLAR
YLHELKRAAEEIDLRGYFQWSLMDNFEWAKGYSERFGLVYVDFRTQKRILKDSAYWYRDM
IQDNGKNL

Enzyme Prediction     

No EC number prediction in MGYG000000031_02079.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	6	245	1e-65	0.5081585081585082

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00232	Glyco_hydro_1	3.03e-66	8	245	212	452	Glycosyl hydrolase family 1.
COG2723	BglB	1.24e-56	12	246	219	455	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK13511	PRK13511	3.32e-41	22	238	222	460	6-phospho-beta-galactosidase; Provisional
PRK09589	celA	2.82e-28	20	248	240	476	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	5.19e-22	22	248	246	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL23046.1	1.24e-150	1	246	225	470
BBF42853.1	2.40e-110	2	248	205	451
CBL10433.1	5.61e-109	2	245	204	448
VCV21232.1	7.91e-109	2	245	204	448
CBL12378.1	2.21e-108	2	245	204	448

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1OD0_A	2.84e-61	12	245	239	465	Family1 b-glucosidase from Thermotoga maritima [Thermotoga maritima],1OD0_B Family 1 b-glucosidase from Thermotoga maritima [Thermotoga maritima],1OIF_A Family 1 b-glucosidase from Thermotoga maritima [Thermotoga maritima],1OIF_B Family 1 b-glucosidase from Thermotoga maritima [Thermotoga maritima],1OIM_A Family 1 b-glucosidase from Thermotoga maritima [Thermotoga maritima],1OIM_B Family 1 b-glucosidase from Thermotoga maritima [Thermotoga maritima],1OIN_A Family 1 b-glucosidase from Thermotoga maritima [Thermotoga maritima],1OIN_B Family 1 b-glucosidase from Thermotoga maritima [Thermotoga maritima],1UZ1_A Family 1 b-glucosidase from Thermotoga maritima in complex with isofagomine lactam [Thermotoga maritima],1UZ1_B Family 1 b-glucosidase from Thermotoga maritima in complex with isofagomine lactam [Thermotoga maritima],1W3J_A Family 1 b-glucosidase from Thermotoga maritima in complex with tetrahydrooxazine [Thermotoga maritima],1W3J_B Family 1 b-glucosidase from Thermotoga maritima in complex with tetrahydrooxazine [Thermotoga maritima],2CBU_A Beta-glucosidase from Thermotoga maritima in complex with castanospermine [Thermotoga maritima],2CBU_B Beta-glucosidase from Thermotoga maritima in complex with castanospermine [Thermotoga maritima],2CBV_A Beta-glucosidase from Thermotoga maritima in complex with calystegine B2 [Thermotoga maritima],2CBV_B Beta-glucosidase from Thermotoga maritima in complex with calystegine B2 [Thermotoga maritima],2CES_A Beta-glucosidase from Thermotoga maritima in complex with glucoimidazole [Thermotoga maritima],2CES_B Beta-glucosidase from Thermotoga maritima in complex with glucoimidazole [Thermotoga maritima],2CET_A Beta-glucosidase from Thermotoga maritima in complex with phenethyl- substituted glucoimidazole [Thermotoga maritima],2CET_B Beta-glucosidase from Thermotoga maritima in complex with phenethyl- substituted glucoimidazole [Thermotoga maritima],2J75_A Beta-glucosidase from Thermotoga maritima in complex with noeuromycin [Thermotoga maritima],2J75_B Beta-glucosidase from Thermotoga maritima in complex with noeuromycin [Thermotoga maritima],2J77_A Beta-glucosidase from Thermotoga maritima in complex with deoxynojirimycin [Thermotoga maritima],2J77_B Beta-glucosidase from Thermotoga maritima in complex with deoxynojirimycin [Thermotoga maritima],2J78_A Beta-glucosidase from Thermotoga maritima in complex with gluco- hydroximolactam [Thermotoga maritima],2J78_B Beta-glucosidase from Thermotoga maritima in complex with gluco- hydroximolactam [Thermotoga maritima],2J79_A Beta-glucosidase from Thermotoga maritima in complex with galacto- hydroximolactam [Thermotoga maritima],2J79_B Beta-glucosidase from Thermotoga maritima in complex with galacto- hydroximolactam [Thermotoga maritima],2J7B_A Beta-glucosidase from Thermotoga maritima in complex with gluco- tetrazole [Thermotoga maritima],2J7B_B Beta-glucosidase from Thermotoga maritima in complex with gluco- tetrazole [Thermotoga maritima],2J7C_A Beta-glucosidase from Thermotoga maritima in complex with phenylaminomethyl-derived glucoimidazole [Thermotoga maritima],2J7C_B Beta-glucosidase from Thermotoga maritima in complex with phenylaminomethyl-derived glucoimidazole [Thermotoga maritima],2J7D_A Beta-glucosidase from Thermotoga maritima in complex with methoxycarbonyl-substituted glucoimidazole [Thermotoga maritima],2J7D_B Beta-glucosidase from Thermotoga maritima in complex with methoxycarbonyl-substituted glucoimidazole [Thermotoga maritima],2J7E_A Beta-glucosidase from Thermotoga maritima in complex with methyl acetate-substituted glucoimidazole [Thermotoga maritima],2J7E_B Beta-glucosidase from Thermotoga maritima in complex with methyl acetate-substituted glucoimidazole [Thermotoga maritima],2J7F_A Beta-glucosidase from Thermotoga maritima in complex with carboxylate- substituted glucoimidazole [Thermotoga maritima],2J7F_B Beta-glucosidase from Thermotoga maritima in complex with carboxylate- substituted glucoimidazole [Thermotoga maritima],2J7G_A Beta-glucosidase from Thermotoga maritima in complex with methyl acetic acid-substituted glucoimidazole [Thermotoga maritima],2J7G_B Beta-glucosidase from Thermotoga maritima in complex with methyl acetic acid-substituted glucoimidazole [Thermotoga maritima],2J7H_A Beta-glucosidase from Thermotoga maritima in complex with azafagomine [Thermotoga maritima],2J7H_B Beta-glucosidase from Thermotoga maritima in complex with azafagomine [Thermotoga maritima],2JAL_A Beta-glucosidase from Thermotoga maritima in complex with cyclophellitol [Thermotoga maritima],2JAL_B Beta-glucosidase from Thermotoga maritima in complex with cyclophellitol [Thermotoga maritima],2VRJ_A Beta-glucosidase from Thermotoga maritima in complex with N-octyl-5- deoxy-6-oxa-N-(thio)carbamoylcalystegine [Thermotoga maritima],2VRJ_B Beta-glucosidase from Thermotoga maritima in complex with N-octyl-5- deoxy-6-oxa-N-(thio)carbamoylcalystegine [Thermotoga maritima],2WBG_A Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-oxa-(+)-castanospermine [Thermotoga maritima],2WBG_B Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-oxa-(+)-castanospermine [Thermotoga maritima],2WBG_C Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-oxa-(+)-castanospermine [Thermotoga maritima],2WBG_D Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-oxa-(+)-castanospermine [Thermotoga maritima],2WC3_A Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-oxa-(+)-8-epi-castanospermine [Thermotoga maritima],2WC3_B Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-oxa-(+)-8-epi-castanospermine [Thermotoga maritima],2WC3_C Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-oxa-(+)-8-epi-castanospermine [Thermotoga maritima],2WC3_D Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-oxa-(+)-8-epi-castanospermine [Thermotoga maritima],2WC4_A Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-thia-(+)-castanospermine [Thermotoga maritima],2WC4_B Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-thia-(+)-castanospermine [Thermotoga maritima],2WC4_C Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-thia-(+)-castanospermine [Thermotoga maritima],2WC4_D Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-thia-(+)-castanospermine [Thermotoga maritima],5N6S_A Thermotoga maritima family 1 Glycoside hydrolase complexed with Carba-Cyclophellitol transition state mimic [Thermotoga maritima],5N6S_B Thermotoga maritima family 1 Glycoside hydrolase complexed with Carba-Cyclophellitol transition state mimic [Thermotoga maritima],5N6S_C Thermotoga maritima family 1 Glycoside hydrolase complexed with Carba-Cyclophellitol transition state mimic [Thermotoga maritima],5N6S_D Thermotoga maritima family 1 Glycoside hydrolase complexed with Carba-Cyclophellitol transition state mimic [Thermotoga maritima],5N6T_A Thermotoga maritima family 1 glycoside hydrolase complexed with a cyclophellitol analogue transition state mimic [Thermotoga maritima],5N6T_B Thermotoga maritima family 1 glycoside hydrolase complexed with a cyclophellitol analogue transition state mimic [Thermotoga maritima],5OSS_A Beta-glucosidase from Thermotoga maritima in complex with Gluco-1H-imidazole [Thermotoga maritima MSB8],5OSS_B Beta-glucosidase from Thermotoga maritima in complex with Gluco-1H-imidazole [Thermotoga maritima MSB8]
5IDI_A	2.15e-60	12	245	215	441	Structureof beta glucosidase 1A from Thermotoga neapolitana, mutant E349A [Thermotoga neapolitana],5IDI_B Structure of beta glucosidase 1A from Thermotoga neapolitana, mutant E349A [Thermotoga neapolitana]
6Z1H_A	6.91e-56	12	248	222	452	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
7E5J_A	6.10e-54	54	241	249	441	ChainA, Beta-glucosidase [Thermoanaerobacterium saccharolyticum JW/SL-YS485]
1QOX_A	1.58e-50	12	241	216	442	ChainA, Beta-glucosidase [Niallia circulans subsp. alkalophilus],1QOX_B Chain B, Beta-glucosidase [Niallia circulans subsp. alkalophilus],1QOX_C Chain C, Beta-glucosidase [Niallia circulans subsp. alkalophilus],1QOX_D Chain D, Beta-glucosidase [Niallia circulans subsp. alkalophilus],1QOX_E Chain E, Beta-glucosidase [Niallia circulans subsp. alkalophilus],1QOX_F Chain F, Beta-glucosidase [Niallia circulans subsp. alkalophilus],1QOX_G Chain G, Beta-glucosidase [Niallia circulans subsp. alkalophilus],1QOX_H Chain H, Beta-glucosidase [Niallia circulans subsp. alkalophilus],1QOX_I Chain I, Beta-glucosidase [Niallia circulans subsp. alkalophilus],1QOX_J Chain J, Beta-glucosidase [Niallia circulans subsp. alkalophilus],1QOX_K Chain K, Beta-glucosidase [Niallia circulans subsp. alkalophilus],1QOX_L Chain L, Beta-glucosidase [Niallia circulans subsp. alkalophilus],1QOX_M Chain M, Beta-glucosidase [Niallia circulans subsp. alkalophilus],1QOX_N Chain N, Beta-glucosidase [Niallia circulans subsp. alkalophilus],1QOX_O Chain O, Beta-glucosidase [Niallia circulans subsp. alkalophilus],1QOX_P Chain P, Beta-glucosidase [Niallia circulans subsp. alkalophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B9K7M5	8.95e-61	12	245	215	441	1,4-beta-D-glucan glucohydrolase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=gghA PE=1 SV=2
Q08638	9.38e-61	12	245	217	443	Beta-glucosidase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=bglA PE=1 SV=1
P0C946	1.25e-51	12	229	215	425	1,4-beta-D-glucan glucohydrolase (Fragment) OS=Thermotoga neapolitana OX=2337 GN=bglA PE=3 SV=1
Q03506	8.83e-50	12	241	217	443	Beta-glucosidase OS=Niallia circulans OX=1397 GN=bglA PE=1 SV=3
P26208	4.90e-48	12	245	217	447	Beta-glucosidase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000036	0.000003	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000031_02079.