CAZyme Information: MGYG000000032_00013

Basic Information

• Species: Hungatella effluvii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella; Hungatella effluvii
• CAZyme ID: MGYG000000032_00013
• CAZy Family: GT108
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315	MGYG000000032_1|CGC1	35644.99	4.6734

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000032	6969476	Isolate	United Kingdom	Europe

• Gene Location: Start: 12682; End: 13629 Strand: +

Full Sequence      

MLQQRDNTLRTCKELLLEFNQVKNQVKSSKIKFSLKQNGKDVYNITAPFLADGKTWIAGR
VEARDSEYSRIGFFEESEGEWVETEREALNLQDPFVTRIGGKLVLGGVEVFDDEEQPGYL
NYRTVFYRGDGILDLSRFAVGPDRMKDIRLCELEDGRILVLTRPQGERGGRGKIGYRFFE
SLDELDAESLQQATLMEHQFIPEEWGGANELHRIAGGKIGVLSHIAGFDTEGNRHYYSTA
FCFNPETGEYGPMKMIAERRNFQPGPSKRPDLEDVIFSGGLVRLGGGKAELYCGVSDAEG
QKVLIDDPFDEYENR

Enzyme Prediction     

No EC number prediction in MGYG000000032_00013.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT108	23	309	9.4e-114	0.9828178694158075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08950	DUF1861	2.28e-146	18	310	2	295	Protein of unknown function (DUF1861). This hypothetical protein, found in bacteria and in the eukaryote Leishmania, has no known function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALS29888.1	5.87e-117	11	314	12	316
AZR73250.1	9.42e-117	11	313	11	313
QKE71427.1	1.12e-115	12	313	12	313
QSW18494.1	2.36e-115	10	309	4	303
QNF27301.1	3.21e-115	9	314	9	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q50_A	2.60e-46	38	309	46	317	Structureof MPT-4, a mannose phosphorylase from Leishmania mexicana, in complex with phosphate ion [Leishmania mexicana MHOM/GT/2001/U1103]
6Q4X_A	1.76e-44	38	312	56	332	Structureof MPT-2, a GDP-Man-dependent mannosyltransferase from Leishmania mexicana [Leishmania mexicana MHOM/GT/2001/U1103],6Q4X_B Structure of MPT-2, a GDP-Man-dependent mannosyltransferase from Leishmania mexicana [Leishmania mexicana MHOM/GT/2001/U1103],6Q4Y_A Structure of MPT-2, a GDP-Man-dependent mannosyltransferase from Leishmania mexicana, in complex with mannose [Leishmania mexicana MHOM/GT/2001/U1103],6Q4Y_B Structure of MPT-2, a GDP-Man-dependent mannosyltransferase from Leishmania mexicana, in complex with mannose [Leishmania mexicana MHOM/GT/2001/U1103]
6Q4Z_A	9.55e-44	38	312	56	332	Structureof an inactive variant (D94N) of MPT-2, a GDP-Man-dependent mannosyltransferase from Leishmania mexicana, in complex with beta-1,2-mannobiose [Leishmania mexicana MHOM/GT/2001/U1103],6Q4Z_B Structure of an inactive variant (D94N) of MPT-2, a GDP-Man-dependent mannosyltransferase from Leishmania mexicana, in complex with beta-1,2-mannobiose [Leishmania mexicana MHOM/GT/2001/U1103]
2B4W_A	7.76e-43	38	309	26	297	Hypotheticalprotein from leishmania major [Leishmania major]
6Q4W_A	2.61e-40	41	310	66	337	Structureof MPT-1, a GDP-Man-dependent mannosyltransferase from Leishmania mexicana [Leishmania mexicana MHOM/GT/2001/U1103],6Q4W_B Structure of MPT-1, a GDP-Man-dependent mannosyltransferase from Leishmania mexicana [Leishmania mexicana MHOM/GT/2001/U1103]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000032_00013.