CAZyme Information: MGYG000000032_00269

Basic Information

• Species: Hungatella effluvii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella; Hungatella effluvii
• CAZyme ID: MGYG000000032_00269
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
392	MGYG000000032_1|CGC7	44745.06	4.995

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000032	6969476	Isolate	United Kingdom	Europe

• Gene Location: Start: 309530; End: 310708 Strand: +

Full Sequence      

MAQTLNTIRNYPGMEEGMTTTALNGAVAVIRENLPVFTEKFQSSNSFGGFYEPTENVEWT
TGFWTGSIWLAYEHTGDEAFKKAADIQVESFLERIEKKIDVNHHDMGFLYSLSCVAAYKL
TGNEHAKKAALLAADHLAERYREKGNFLQAWGNPGEPKEYRLIIDCLLNLPILYWATEVT
GDESYAQKAEHHIKTAMKCILRPDNSTYHTHFFDVETGEPTYGVTHQGNRNGSAWARGQA
WGVYGIALSYRYLKNPEYIDLFCRVTDYFIEHLPEDLVPYWDFDFDTGSTEPRDSSASAI
AVCGILEMAKYLDQEKADRYLTAADRMLRALVDHCANTDITKSNGLLLHGTYARDSRENT
CTNRGVDECNTWGDYFYMEALTRLSKDWKLYW

Enzyme Prediction     

No EC number prediction in MGYG000000032_00269.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	53	384	5.1e-134	0.9908814589665653

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.35e-34	49	383	19	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET72495.1	1.58e-250	1	392	1	392
ADL04508.1	9.14e-250	1	392	1	392
QRV21235.1	9.14e-250	1	392	1	392
AWY97334.1	3.93e-200	1	392	1	392
ASM68542.1	2.90e-195	1	392	1	392

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2ZZR_A	1.86e-120	22	392	31	397	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	1.93e-120	22	392	32	398	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3ANI_A	1.10e-119	22	392	32	398	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]
3VXD_A	1.10e-119	22	392	32	398	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_B Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_C Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_D Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316]
3WUX_A	3.12e-119	22	392	32	398	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8DR77	9.35e-123	22	392	30	396	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q9A0T3	7.69e-120	20	392	31	399	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q8E372	1.05e-119	22	392	32	398	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q9RC92	2.10e-95	18	392	1	372	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
T2KLZ3	2.45e-51	33	383	50	393	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999126	0.000846	0.000030	0.000006	0.000002	0.000017

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000032_00269.