CAZyme Information: MGYG000000032_01454

Basic Information

• Species: Hungatella effluvii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella; Hungatella effluvii
• CAZyme ID: MGYG000000032_01454
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
337	MGYG000000032_3|CGC2	39713.5	4.6955

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000032	6969476	Isolate	United Kingdom	Europe

• Gene Location: Start: 133646; End: 134659 Strand: -

Full Sequence      

MANLNDALNLAQEALERCYWDEEKQYYEHHFPRKEEEAFVYWWHAHTVDALLDGYLRTGD
GVYMERIRKELTGTWNANHQTFLHNWYDDMEWIALALLRLWDVTENDACRDQVFTIWEDV
KTAWNDHMGGGLAWQKKQLDYKNTPANAPAAILAFRLYQRFGRPEDLEWGERIFQWNLRH
LVDPDNGFVWDGINRLGDGKVDYEWEFTYCQGVFMQAALEYYHITKDEAYYEMALATFRE
AKRRLADSHGGLIPYEGPDDCGLFRGIFFRYCRELYAEKKNEPEIREMIHFHAETVASRG
MNREGLIGGSWDEPETGTVDLAQHLSGIMVMEMAARC

Enzyme Prediction     

No EC number prediction in MGYG000000032_01454.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	24	323	4.4e-76	0.8547486033519553

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	7.17e-62	6	336	5	351	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam03663	Glyco_hydro_76	1.11e-30	41	271	34	287	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
cd04791	LanC_SerThrkinase	1.36e-04	93	307	91	289	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS97536.1	1.69e-122	11	335	12	338
AGA56980.1	9.87e-114	2	315	12	327
QTH44606.1	5.03e-113	12	335	12	340
AYQ74079.1	1.44e-111	37	335	24	322
AYB46855.1	3.66e-108	2	335	394	731

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K7X_A	2.34e-72	9	336	8	339	ChainA, Lin0763 protein [Listeria innocua]
6SHD_A	2.49e-66	37	335	84	387	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	7.90e-65	37	335	85	388	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	6.17e-64	37	335	85	388	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
4MU9_A	1.42e-20	37	322	52	353	Crystalstructure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482],4MU9_B Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000032_01454.