CAZyme Information: MGYG000000032_01824

Basic Information

• Species: Hungatella effluvii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella; Hungatella effluvii
• CAZyme ID: MGYG000000032_01824
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
721	MGYG000000032_3|CGC5	79926.69	4.9473

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000032	6969476	Isolate	United Kingdom	Europe

• Gene Location: Start: 533737; End: 535902 Strand: -

Full Sequence      

MTMQKIWDLIREMTLEEKIGMIHGQGIFHTKGVERLGIPPLWMSDGPMGVRKELQDDNWA
PKGTTDDYVSYLPSNTAIACTWNRERAADMGCVLGQEARGRGKDVILAPGINLIRSPLCG
RNFEYMSEDPHLISEMAVPLIRGIEEQDTAACVKHFALNNQETRRLDVEAAVDERALREL
YLPGFEAAVKEGKTKTLMGAYNRFRGEHCCHNHYLLQDILRGEWGFDGVVISDWGGVHDT
MQAAENGLDIEMSVTSDFDQYCMADPLAEKVRSGEVPEALLDEKVKNILVLMDRLHMLDG
VRKRGSYNTRDHQEAILKCAEEAIVLLKNEGGILPLKPVKRLAVIGENAGKMHSSGGGSA
AIKALYELTPLMGLKMELGGAVSVEYAPGYQSDGEKSAEQENWQAESLEERAYKASYKGD
GSDAAEKRRRELIREAAALAESCENAVLFIGLNHEFDLEGCDRTDMKLPYGQEELISAVL
DANENTVIAVTAGSPVDMEVFADRAKAIVYSSYNGMEGGLAMAEVLLGRVNPSGRLPFTI
PKRLEDCPAHSIGEFPGGDTVAYRESVYVGYRYYETERKAVRYCFGHGLSYTEFSYGNLK
LERREDGIYGTVTVRNCGSAAGAEVVEIYVGAAGKTVKRPARELKGFVKVRLQPGEERAV
DFRLPWKAFSYYNEEKMAFEVPEDEYSVCVGRSVGDVRLVQTVEIKENDALGGKCRSITH
V

Enzyme Prediction     

No EC number prediction in MGYG000000032_01824.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	252	3.7e-66	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	3.52e-88	6	698	38	758	beta-glucosidase BglX.
COG1472	BglX	7.57e-71	35	362	57	375	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	2.14e-64	9	675	56	754	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	1.44e-62	324	571	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	1.24e-38	35	291	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF45282.1	1.11e-282	5	699	9	708
QNU68450.1	4.08e-268	5	707	5	711
ABX40607.1	3.09e-264	6	706	9	721
QAA33077.1	6.84e-264	2	705	8	684
BAV13087.1	4.67e-260	5	705	6	681

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	3.39e-164	6	705	5	668	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.26e-127	4	705	3	663	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.39e-120	3	707	1	715	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	4.18e-120	8	707	8	838	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
2X42_A	2.10e-119	3	707	1	715	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS8	1.46e-163	5	704	45	744	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
P14002	1.86e-163	6	705	5	668	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
Q5BFG8	1.87e-127	5	697	10	830	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
F6C6C1	2.44e-125	4	719	3	682	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	4.81e-125	4	697	3	664	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000032_01824.