CAZyme Information: MGYG000000032_02397

Basic Information

• Species: Hungatella effluvii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella; Hungatella effluvii
• CAZyme ID: MGYG000000032_02397
• CAZy Family: PL8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1843	MGYG000000032_5|CGC4	199015.48	4.3693

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000032	6969476	Isolate	United Kingdom	Europe

• Gene Location: Start: 181767; End: 187298 Strand: -

Full Sequence      

MCLVFQMAVTSPAAAVTLPAGKQQSKFNTGQYAAVLDPSAGGGSLALFNGSRPDQAWNTM
DEALVPGTTMLWDGSSGFRKLQITPEAVMSAGLNSGAATGIRLGNEAEGVKSWFLFEDEI
ICAGAGVKVRKEESGRLVTIVDTIPVTDTTKLALTNPNNGFRLVRTASKEGGLWASLIDT
VTQGVHTQRNWLSASSGSGASNSLDWSYVFGSGESGSYLTKESVYYRLNTKETDAAQLAE
LFLAPQETYQYTLVAGGTTDDYSNKSLYQTDARLLINTTAVQAAADVGEGAVAITKWEPG
SVRVDNQVVPVTMDYPAALELKKDSSTGNIELTAAVMPSQQDGILEVILETAGKQILANS
NPDALQEAVMGEKVILKFDTAAMKGNAATVTIEGKVPDTLTGEEITLVRGSDGRIKAPES
LQGAIRWEVKIPKPDGSFVRNAGSSKIKRELKEGETDGDRKAGDADGSHIASVRGAADGY
GMITAREKGTVTIVATDEHGTSAKWQVTVLYEDPDNLPEADSADYAAIRKRWKESIIGAD
LTAVDGGTEILETIDGRAMAAWEAYAYRGQDSCQDIPWPEDAGAAGNADIAYEDDAVEFR
PAFKKVLAMASAYAAKGSRYYKDSQMLSDMKHILNWLCSNCYTPKTQTDNWWTWEIGLPK
DLIPALVLLYDDLTPEETALYTEALYFFQPDPYHEGLIGTGSTHAQGYRTAQGANIIDCS
RTALGLGVLREDNELVYLASKAASETFVIQSVEDSTKIADQGYTSGFYADGSYLDHSHVP
YLGSYGIEFLKGGVGLPPLLAKSPWDFPREVQENLEFYLKEGFLNGIYNGLMMDSLKGRS
VSRPGASDRDSGREAMALMIQLMNSVSPEVEEELRGALKTWIDLDPGFLDTLTGAENMAV
KEKAIEIRDDDSIVSSIQPVHKNMPLMDRAVHRTDDFQLALSMYSERIQNTEIMNHENRY
GWHQGSGMTYLYNRDILQYTENFWNTVNPLRLAGTTVVSKDIGTGQPDSSGFAQGGDFRS
KESWVGGSTIGTNGINGMSMTGEVRVKESEGSPSILYAPEFSAKKSWFMFGGQIVCLGAG
ITNTGESYPVESIIENRRLRPEEDNVLTVNGEAEDLPVQEADLEDIVAGSIDVSGTRIPE
VSWAHLEGNVEGSDIGYYFPGGDQTVSVRKGRNAGDWSLIGTSKGEALETYLEMWFDHGA
NPENDAYEYVLLPGLSAEETEAYSKEPGITILKNTPEIQAAATADGLLTGVNFWTDGQAE
IGAVAASRAASVMTEEDEDGKLTIAVSDPTMKNSGSITVDIKRPAEEILTHDENVDVQLT
ENGVRLVVHTKGTNGTSSYASVRLTPAVILPSVEHVVELITQAAETAEAAGDYGAFDVVK
AVKTAVSAVWSVSNEELAEYCMKDLLVLEELYREVMAARGNRVEVRVETPELMESPVTAA
GLLLSVPWDDSLMPATPSQAKKATPSNAGYKAFGAARQSAAPSTATPSTATPSTADSPSS
ASSKEKKEAGVRAAVHSVILTVTENSDAGWPEDRPRGDWSQSYKFQLCLEDENGVRSGPV
AWKAPANVWMQFSEDEVQTDTIRAYSDTGSGEVQSLSVSLEEAGRICFVLPDSARVYLTG
DKTTAAEEIFQVSIEEDLTGGRITASPMSGKKGTKVTVQAVPQSGYRLAGLSANGKSLTA
DSDGRCTFVLREDTHLTGVFKRSGSSSSGSGSSSGFNSGWKKSGEVWYYYDTNGRKTTGW
LLDNGKWYWLDSSGAMKTGWLLNESDGFWYYLKPDGSMAEGWNSLNGVWYYFAPQTEGSP
GWSLVNGRWVYEKPEASYRPHGAMYSGCVTPDGYTVAEDGAWN

Enzyme Prediction     

No EC number prediction in MGYG000000032_02397.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	923	1217	1.8e-76	0.9845559845559846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01083	GAG_Lyase	2.05e-166	524	1289	1	693	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
pfam02278	Lyase_8	5.24e-77	921	1216	1	252	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam08124	Lyase_8_N	4.51e-64	609	880	68	323	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
NF033838	PspC_subgroup_1	1.30e-28	1718	1833	486	593	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033840	PspC_relate_1	2.33e-27	1718	1842	510	646	PspC-related protein choline-binding protein 1. Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET74231.1	0.0	1	1843	15	1913
ASM70662.1	0.0	379	1348	51	1014
ASM68536.1	6.89e-298	403	1299	11	901
SQI63227.1	1.19e-140	302	1351	165	1132
AHB61202.1	1.69e-140	481	1347	300	1096

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F2P_A	2.24e-105	589	1345	60	752	Structureof Paenibacillus xanthan lyase to 2.6 A resolution [Paenibacillus]
1J0M_A	3.76e-100	522	1344	1	751	CrystalStructure of Bacillus sp. GL1 Xanthan Lyase that Acts on Side Chains of Xanthan [Bacillus sp. GL1],1J0N_A Crystal Structure of Bacillus sp. GL1 Xanthan Lyase that Acts on Side Chains of Xanthan [Bacillus sp. GL1]
1X1H_A	3.76e-100	522	1344	1	751	ChainA, xanthan lyase [Bacillus sp. GL1],1X1I_A Chain A, xanthan lyase [Bacillus sp. GL1],1X1J_A Chain A, xanthan lyase [Bacillus sp. GL1]
2E22_A	5.10e-100	522	1344	1	751	Crystalstructure of xanthan lyase in complex with mannose [Bacillus sp. GL1]
2E24_A	5.10e-100	522	1344	1	751	ChainA, Xanthan lyase [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9AQS0	1.41e-97	522	1344	26	776	Xanthan lyase OS=Bacillus sp. (strain GL1) OX=84635 GN=xly PE=1 SV=1
Q59801	1.28e-60	630	1253	144	729	Hyaluronate lyase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=hysA PE=3 SV=1
Q54873	5.41e-58	603	1294	359	997	Hyaluronate lyase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0314 PE=1 SV=2
Q53591	5.09e-57	594	1239	311	923	Hyaluronate lyase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=hylB PE=1 SV=2
P0CZ01	7.21e-52	604	1337	109	791	Hyaluronate lyase OS=Cutibacterium acnes (strain DSM 16379 / KPA171202) OX=267747 GN=PPA0380 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.767183	0.232061	0.000234	0.000223	0.000135	0.000172

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000032_02397.