CAZyme Information: MGYG000000032_02706

Basic Information

• Species: Hungatella effluvii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella; Hungatella effluvii
• CAZyme ID: MGYG000000032_02706
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393	MGYG000000032_6|CGC3	45027.25	4.9274

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000032	6969476	Isolate	United Kingdom	Europe

• Gene Location: Start: 122367; End: 123548 Strand: +

Full Sequence      

MNADTIRRLNEKNELSGEACRQAMDFAAGQVKENLKEFTHSFKKAYSEEGFYRPTPNVNW
TTGFWTGQIWLAYEWSRDEMFKEAGAIQIDSFYKRIETKADVDHHDMGFLYSPSCVAGYK
LTGNGQGKRAAVMAADQLITRYHPIGEFIQAWGPMDQPENYRFIIDCLLNLPLLYWASEE
TGDAKYRDIAEKHIHTAIANVIREDYSTWHTFFMNMETGEPDHGATCQGYRDGSAWARGQ
AWGVYGTAMAYRYTKREEYISDFKHVTGYFLDHLPEDLVPYWDLEFGDGSGEPRDSSSAS
IAACGMLEMAKYLNDEDAKYYTSIAKKIMKSVVENYAVKSGAESNGLVLHSTYSKKSPYN
TCTPEGVDECNIWGDYFYMEALTRLSKDWNPYW

Enzyme Prediction     

No EC number prediction in MGYG000000032_02706.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	55	385	4.7e-130	0.9878419452887538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.61e-29	43	384	12	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET68652.1	2.32e-248	1	393	1	393
AEN95952.1	9.15e-226	8	393	2	387
AWY99292.1	3.59e-225	12	393	5	386
CBL08198.1	3.55e-204	12	393	8	395
CBL12710.1	5.04e-204	12	393	8	395

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2ZZR_A	4.20e-122	22	393	30	397	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	4.34e-122	22	393	31	398	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3ANI_A	2.47e-121	22	393	31	398	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]
3VXD_A	2.47e-121	22	393	31	398	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_B Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_C Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_D Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316]
3WUX_A	3.50e-121	22	393	31	398	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9A0T3	3.34e-129	8	393	18	399	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q8DR77	1.73e-128	15	393	22	396	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q8E372	2.37e-121	22	393	31	398	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q9RC92	3.47e-94	21	393	3	372	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
T2KLZ3	1.14e-53	56	387	73	396	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999841	0.000140	0.000019	0.000002	0.000000	0.000012

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000032_02706.