CAZyme Information: MGYG000000032_02754

Basic Information

• Species: Hungatella effluvii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella; Hungatella effluvii
• CAZyme ID: MGYG000000032_02754
• CAZy Family: GH2
• CAZyme Description: Exo-beta-D-glucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
822	MGYG000000032_6|CGC5	95787.13	4.8589

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000032	6969476	Isolate	United Kingdom	Europe

• Gene Location: Start: 195494; End: 197962 Strand: +

Full Sequence      

MKSYMELNENWSMRKSGDTKWRPASIPGSVYSNLLEQGEMKNPYYGENQYEVCEISRNDF
EFACYFIVTEDIIAQEKNFLQFDGLDTLVDIYLNGQKLGRADNMHRTWRYDVTGAINTEL
NELKLYFYSPIRYIEEKQAERPLWGVATTIPGYPYLRKAHFMYGWDWGPQLPDMGIWRKV
TLYGVSKALLDNIHIRQEHKSGGVELSIQAEIEAFSEGRFDMDVRILDPEGKVIAICKKR
LNGKDCNCEMKINNPKLWWPNGYGEQPLYTVEARLMEGDCCIDSKTVRTGLRTIRVSRDD
DQWGQEFCIVVNETKIFAMGADYIPEDQIISRCSPSKTRHLLEQCVKANFNHIRVWGGGC
YPEDYFFDICDELGLLVWQDFMFACAVYRMSEDFTNNIRQEIIENVKRIRNHASLALWCG
NNEMETAWDSWEIPQDQDLKEDYLFQFEELIPEICRQYDPDTFYWPSSPSCGGNFEDPNS
YTRGDVHYWDVWHGMKPLTEFRKFYFRFCSEYGFMSLPNQKTINDFAAPEECNLFSAVME
AHQKCDDGNKKLLYYLSQMVSYPYSFEGLIYATQLLQADAIRSNVEHMRRNRGRCMGSTY
WQVNDSNPIISWSSIDYNGRWKALHYYAKRFYAPVLLSVNEENLEEVVFNISNEQVTGIE
GVICWTLRDAGAHVLKEGKAEVKAAPLSAKDCFQLNLSKELDTIEKKRSHYLEYAFYDST
GQNRSYGTTLFVMPKHFRFKSPNITFCVTEETGGYRIQLKAEAFAKGVCLDLKKYDCSFS
DNWFDIHGEETVSVWVGRDTISHAIDRNELEENLIIYCSNDL

Enzyme Prediction     

No EC number prediction in MGYG000000032_02754.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	712	3.7e-101	0.7127659574468085

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.27e-100	7	638	15	635	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam00703	Glyco_hydro_2	1.51e-13	190	292	3	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam17753	Ig_mannosidase	1.95e-11	742	821	2	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
PRK10340	ebgA	3.95e-11	76	423	126	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK10150	PRK10150	3.18e-10	175	296	169	280	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCO04426.1	1.65e-308	5	816	5	820
AUG59052.1	2.49e-297	5	816	3	811
QUH28340.1	9.17e-287	5	816	4	812
ADU28568.1	8.50e-285	7	816	6	812
AWB45455.1	2.15e-280	5	822	4	817

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	3.35e-160	5	786	9	806	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	3.54e-160	5	786	11	808	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	3.65e-160	5	786	11	808	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	9.62e-160	5	786	9	806	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	4.03e-158	5	786	9	806	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2TXB7	8.23e-103	3	643	5	664	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
Q29444	3.36e-102	5	784	23	844	Beta-mannosidase OS=Bos taurus OX=9913 GN=MANBA PE=1 SV=1
Q95327	9.06e-102	5	784	23	844	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
B8NW36	2.27e-101	3	643	5	664	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
A1CGA8	3.24e-101	7	643	9	664	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000007	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000032_02754.