CAZyme Information: MGYG000000032_02895

Basic Information

• Species: Hungatella effluvii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella; Hungatella effluvii
• CAZyme ID: MGYG000000032_02895
• CAZy Family: GH3
• CAZyme Description: Beta-N-acetylglucosaminidase/beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
573	MGYG000000032_7|CGC2	63565.22	5.3997

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000032	6969476	Isolate	United Kingdom	Europe

• Gene Location: Start: 49153; End: 50874 Strand: -

Full Sequence      

MVDLRGNPFYLDEAGERWVKETEAAMTPHEKVCQLFADPLMGKSREELIQFLEEYPLAAI
PFRAVLYGNEEAQDIMAELQERAKIPYLYAGNCESGPNGALKGGTLVASGAQVRATRDAR
YAYEVGRITGSETSAVGYNWTFGPVGDIYGNWRNSLINTRAYGSDSQFVSDCVEAYNKGC
MEYGVVPCLKHFPGDGWEERDQHLAISNNGLTCEEWDKTYGKIYQTAINHGVLSIMAAHF
TLPAYQKKLNPQLEERDMQPACLSRELIGGLLRGRLGFHGLVVTDQTKMMGYYGMSRLDA
IPLSIACGCDMILGINDIEEDVEAMKAGLKSGIVTEERLTEAIYRILACKAAIGLHRRKE
SGSFHPGKEALARIGCREHLEIAREASQKAVTLVKNTKGQLPLSPEVYKKIGVFVLSGNV
GSLNSSYGQGVQSGGSDQITERILAALKKYGYEPELMVSSVNKGKIADFKAKYDAVMIFA
DITSFAQTNSVRLLWPHPMSSCYPWYIHDVPTVFTSFNYTNHLVDVARVPAFINAYNDTP
ETVDETVKRIAGLAPFEGNYDEDVWCGMWDTHF

Enzyme Prediction     

No EC number prediction in MGYG000000032_02895.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	79	313	1.5e-49	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	3.59e-66	26	436	1	382	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.79e-48	30	347	4	314	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	1.76e-19	120	324	97	289	beta-hexosaminidase; Provisional
PRK15098	PRK15098	5.98e-11	124	418	137	417	beta-glucosidase BglX.
PLN03080	PLN03080	8.91e-05	260	403	273	415	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCX33673.1	3.25e-173	1	571	3	564
ADQ14511.1	1.03e-169	1	571	1	566
AZP04845.1	1.66e-167	1	571	1	562
QLC59446.1	1.74e-167	1	571	3	574
QEK07326.1	1.74e-167	1	571	3	574

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VQD_A	2.18e-109	8	571	10	565	Beta-glucosidephosphorylase BglX [unidentified],5VQE_A Beta-glucoside phosphorylase BglX bound to 2FGlc [unidentified]
3BMX_A	5.78e-38	41	411	70	455	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	2.13e-37	41	411	44	429	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	2.76e-37	41	411	74	459	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
6K5J_A	1.08e-36	25	558	10	525	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7WUL3	4.22e-120	1	572	1	563	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
P40406	3.17e-37	41	411	70	455	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
Q7NWB7	1.12e-22	60	329	34	298	Beta-hexosaminidase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=nagZ PE=3 SV=1
Q5FA94	1.53e-19	122	316	107	290	Beta-hexosaminidase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=nagZ PE=1 SV=1
A9M1Z4	6.74e-19	122	316	107	290	Beta-hexosaminidase OS=Neisseria meningitidis serogroup C (strain 053442) OX=374833 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000032_02895.