CAZyme Information: MGYG000000032_03636

Basic Information

• Species: Hungatella effluvii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella; Hungatella effluvii
• CAZyme ID: MGYG000000032_03636
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
472	MGYG000000032_10|CGC6	52925.54	4.5578

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000032	6969476	Isolate	United Kingdom	Europe

• Gene Location: Start: 98739; End: 100157 Strand: +

Full Sequence      

METFYSVKDFGAAGDGKSLDTEAIQAAIDRCSQEGGGYVLLEKGEFISGTLYMKSGVYLI
VTASAKLTASGSIAAYGTDTHYNRYVNEHDMDRCFIYAEEAENFGIMGEGIIDGNAESFP
NEGSIYRPMMIRFLRCRDVKLKGIKLYQSAAWTTAFLDSENIWVEDLEICNDKRYNGDGL
DFDGCRNVFVARCRISGTDDNLCLQAGSREYPVENIHISDCHFTSICAGIRIGLKSIGDI
RNVTVSGCTFQNVWREGIKIECTEGGNISDICIQGNTMHNVSRPVFILLNNRMEEIGSSV
ELKEMPEIGTLKRVTISGLIIRDDEEMEKIHYRFQDDVMGKPEFGGIRVDANKDHPIENL
VFQNIDYTAIGGVRLDEIPEGYPEVPDYKAGDTAKYNKTGDKSNIRLDTGKTEAAVSENY
YPDWSRTTHLDIRNVKNLILAQVILSTVHEDERPKYLVEGCRCLREEIYDLD

Enzyme Prediction     

No EC number prediction in MGYG000000032_03636.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	27	368	7.7e-55	0.9230769230769231

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	2.87e-52	2	299	80	416	Polygalacturonase [Carbohydrate transport and metabolism].
PLN02218	PLN02218	4.82e-15	3	287	66	351	polygalacturonase ADPG
PLN02793	PLN02793	1.23e-11	7	287	55	336	Probable polygalacturonase
pfam00295	Glyco_hydro_28	2.14e-10	31	287	1	246	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN02188	PLN02188	5.12e-09	3	287	35	316	polygalacturonase/glycoside hydrolase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ52829.1	1.39e-209	1	470	1	450
QKS46534.1	7.99e-209	1	468	1	448
AIQ30101.1	4.34e-206	1	470	1	450
ASA21669.1	1.76e-205	1	470	1	450
QTB91007.1	1.37e-161	3	466	2	448

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	7.72e-31	9	319	32	395	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
5OLP_A	4.47e-25	5	368	45	449	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
4MXN_A	1.89e-18	5	215	22	234	Crystalstructure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_B Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_C Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_D Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184]
2UVE_A	4.68e-10	6	288	158	497	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]
2PYG_A	6.79e-10	5	118	3	113	Azotobactervinelandii Mannuronan C-5 epimerase AlgE4 A-module [Azotobacter vinelandii],2PYG_B Azotobacter vinelandii Mannuronan C-5 epimerase AlgE4 A-module [Azotobacter vinelandii],2PYH_A Azotobacter vinelandii Mannuronan C-5 epimerase AlgE4 A-module complexed with mannuronan trisaccharide [Azotobacter vinelandii],2PYH_B Azotobacter vinelandii Mannuronan C-5 epimerase AlgE4 A-module complexed with mannuronan trisaccharide [Azotobacter vinelandii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7PZL3	2.53e-19	6	422	64	491	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
Q8RY29	1.55e-15	3	287	66	351	Polygalacturonase ADPG2 OS=Arabidopsis thaliana OX=3702 GN=ADPG2 PE=2 SV=2
P35336	4.28e-15	6	372	91	433	Polygalacturonase OS=Actinidia deliciosa OX=3627 PE=2 SV=1
P18192	5.67e-14	18	329	49	376	Endo-polygalacturonase OS=Pectobacterium carotovorum subsp. carotovorum OX=555 GN=peh PE=3 SV=1
P05117	1.64e-11	6	372	77	420	Polygalacturonase-2 OS=Solanum lycopersicum OX=4081 GN=PG2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000032_03636.