CAZyme Information: MGYG000000032_03736

Basic Information

• Species: Hungatella effluvii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella; Hungatella effluvii
• CAZyme ID: MGYG000000032_03736
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
522		58447.58	4.8817

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000032	6969476	Isolate	United Kingdom	Europe

• Gene Location: Start: 225815; End: 227383 Strand: +

Full Sequence      

MELKVICMTARSATLETEAGRIFEFDTEGEIYINGSLYKRTNRVIFSLFGLRPDTEYEVC
LKRDGEEARTVFRTDYEFVTLNVKEVGAKGDGIQDDTGFIQAAILACPKNGRVLIPKGVY
RITSLFLKSHIRLELAAGAVLAADTDRFRYPRFPGMIESCDETEDYNLGTWEGNPLPMFA
GIINGIEVEDVVIYGEGLVDGQASFENWWNDVGTMRGAFRPRMVFLERCKSITLQGFHLK
NSPTWVLHPYFSQGLRFLDLDIRNPADSPNTDGLDPESCRDVEIAGLHFSLGDDCIAIKS
GKIYMGRRYKTPSENIEIRQCLMENGHGAVTVGSEVGAGVKAVQVKDCLFRCTDRGLRVK
TRRGRGRDSVLSDISFQHIIMENVMTPFVVNSFYFCDPDGRTDYVQCREALPVDERTPEI
KNLSFKDIKASDCHVAASFLCGLPEQKIRKIELENVEISFAEQAREGVPAMMEGVEACSR
QGFTVMNVDTLICKNVTITGQKGDAFIMSNIDYFENFAGAFS

Enzyme Prediction     

No EC number prediction in MGYG000000032_03736.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	107	486	2.8e-71	0.9230769230769231

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	3.43e-90	81	503	83	535	Polygalacturonase [Carbohydrate transport and metabolism].
PLN02218	PLN02218	1.36e-31	69	458	59	408	polygalacturonase ADPG
pfam00295	Glyco_hydro_28	3.71e-31	183	442	48	289	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN02188	PLN02188	1.64e-29	80	477	36	392	polygalacturonase/glycoside hydrolase family protein
PLN02793	PLN02793	2.06e-28	81	458	53	394	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET55359.1	3.23e-289	1	515	1	515
VCV21973.1	8.73e-233	1	514	1	516
CBL09361.1	8.73e-233	1	514	1	516
CBL11994.1	1.76e-232	1	514	1	516
AEN96748.1	3.64e-227	1	515	1	517

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	5.49e-41	81	461	28	413	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
5OLP_A	9.18e-32	50	366	17	344	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
1BHE_A	3.28e-24	97	459	26	362	ChainA, POLYGALACTURONASE [Pectobacterium carotovorum]
2UVE_A	7.27e-21	46	404	115	510	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]
4MR0_A	8.08e-07	71	141	106	180	Crystalstructure of PfbA, a surface adhesin of Streptococcus pneumoniae [Streptococcus pneumoniae R6],4MR0_B Crystal structure of PfbA, a surface adhesin of Streptococcus pneumoniae [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27644	5.61e-49	222	445	23	247	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
A7PZL3	1.17e-39	80	491	62	455	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
Q8RY29	1.84e-26	80	442	67	393	Polygalacturonase ADPG2 OS=Arabidopsis thaliana OX=3702 GN=ADPG2 PE=2 SV=2
Q9SFB7	2.48e-24	4	458	4	410	Polygalacturonase QRT2 OS=Arabidopsis thaliana OX=3702 GN=QRT2 PE=1 SV=2
P18192	4.06e-24	97	459	52	388	Endo-polygalacturonase OS=Pectobacterium carotovorum subsp. carotovorum OX=555 GN=peh PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000032_03736.