CAZyme Information: MGYG000000032_04272

Basic Information

• Species: Hungatella effluvii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella; Hungatella effluvii
• CAZyme ID: MGYG000000032_04272
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
478	MGYG000000032_13|CGC1	54511.48	4.8757

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000032	6969476	Isolate	United Kingdom	Europe

• Gene Location: Start: 147693; End: 149129 Strand: -

Full Sequence      

MGLSKDFLWGGATAANQCEGGWQEDGRGLSNVDVCPAGPDREAVIRGEHVSLVCDGEHRY
PSHEAIDMYHHFREDIRLFGEMGFKVYRMSIAWTRIFPGGEEEEPNEAGLRFYEEVFRTC
HEYGIEPLVTICHFDCPVHLIEKYGGWRSREMIGFYLKLCRTLFVRYRELVRYWLTFNEI
NMILHAPFLGAGLLFQDGDEREKLKYQAAHHELIASALAVQMAHEINPENRVGCMFAAGS
VYPYSCRPEDVWEALKKDRENYFFVDVQARGEYPAYAGRALEREGLMPVMEDGDERILKK
GTVDFISFSYYNSRCVSTADSAESAEGNLFASAKNPYLTYSEWGWPIDPLGLRITLNQIY
DRYEKPLFIVENGLGAQDFPDENGNVADDCRIDYLKRHICAMMDAAELDGVDLLGYTAWA
PIDLVSAGSGQMKKRYGFIHVDLDDEGNGTGKRMRKKSFGWYQKVIGTNGEWARYGAE

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	470	3e-140	0.986013986013986

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	471	2	474	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	5	471	6	471	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	0.0	5	471	6	455	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	471	4	475	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	1.54e-175	1	471	4	475	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCD37309.1	3.22e-267	1	471	1	472
QMW69893.1	3.22e-267	1	471	1	472
SQI52980.1	1.50e-263	1	471	1	472
AIY84022.1	5.88e-263	1	471	1	471
QUG85179.1	1.23e-262	1	471	1	472

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	5.06e-188	5	471	10	467	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	2.49e-171	3	471	7	478	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
2XHY_A	3.40e-171	3	471	8	477	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F79_A	7.08e-171	3	471	7	478	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	1.52e-167	3	471	7	478	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24240	4.31e-207	5	471	6	471	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P40740	4.84e-188	5	471	10	467	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	3.04e-175	1	471	5	469	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P42973	2.30e-171	3	471	4	477	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46829	1.86e-170	3	471	8	477	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000032_04272.