CAZyme Information: MGYG000000032_05256

Basic Information

• Species: Hungatella effluvii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella; Hungatella effluvii
• CAZyme ID: MGYG000000032_05256
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
586	MGYG000000032_21|CGC1	67329.49	4.6394

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000032	6969476	Isolate	United Kingdom	Europe

• Gene Location: Start: 28167; End: 29927 Strand: +

Full Sequence      

MESIFKVGEFEVISEAAVSCTASMTENGAGRTVMEFQLQSDRISNMGTAVEIRYSFPIID
ICGRWHPNCRADRALKADWEAPVASMTAVSAPVVCFFNSESRNRHTIAASELCQEVDMNA
GVHEEDGRMAVKIRFVLSPQKLSAGYSFRLWESQEDVPYWDTLDQVRQWWEEAMPPVMEV
PDAAREPVYSFWYSWHQDINASIVEEEAERAAKMGFDTIIVDDGWQTGDNNRGYAFCGDW
APEPGKFPDFPEHIRRVHAMGIKYMLWFSVPFVGKNTGCWNRFSDKLLCYDERQQAGVLD
LRYPEVREYLLAVYLKAVREWDLDGLKLDFIDEFYIREGTPVWKEGMDFRDIQEALDVFM
TSVRETLRKEKENLLIEFRQRYIGPNMRRYGNMFRVSDCPCSPVTNRVGCADLRLLCGHS
AVHSDMLMWNRGESPEAAAIQVLSCLFGVPQISVRLADLEEGITEMLRFWLDFMRQHRAL
LQTTVIHAKEPENLYPEVSVENETEEILVHYSAGRVIRPAAQKEITYFVNAQHAQEQILI
LDPERAVSVTVKNCRGEVTETMEWNGGESLVRLSMPACGLCELRWE

Enzyme Prediction     

No EC number prediction in MGYG000000032_05256.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	165	514	2e-36	0.5174418604651163

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	1.75e-75	184	476	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06592	GH31_NET37	5.97e-17	185	348	1	169	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
pfam02065	Melibiase	1.24e-14	192	482	48	345	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
COG3345	GalA	7.01e-11	192	412	299	514	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14792	GH27	3.36e-07	192	264	8	82	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU17504.1	2.20e-213	50	580	51	581
QQQ94451.1	1.13e-177	50	444	51	446
ANU76873.2	2.71e-177	50	444	76	471
ASU29676.1	2.71e-177	50	444	76	471
QUO31288.1	1.18e-176	51	579	50	579

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2YFN_A	4.89e-08	185	329	329	478	galactosidasedomain of alpha-galactosidase-sucrose kinase, AgaSK [[Ruminococcus] gnavus E1],2YFO_A GALACTOSIDASE DOMAIN OF ALPHA-GALACTOSIDASE-SUCROSE KINASE, AGASK, in complex with galactose [[Ruminococcus] gnavus E1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16551	2.65e-10	177	353	283	460	Alpha-galactosidase OS=Escherichia coli OX=562 GN=rafA PE=1 SV=1
Q5ARP5	2.69e-07	185	329	326	485	Probable alpha-galactosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglG PE=2 SV=1
G4T4R7	2.95e-07	185	329	329	478	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000032_05256.