CAZyme Information: MGYG000000032_05632

Basic Information

• Species: Hungatella effluvii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella; Hungatella effluvii
• CAZyme ID: MGYG000000032_05632
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
529	MGYG000000032_26|CGC1	61831.61	4.877

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000032	6969476	Isolate	United Kingdom	Europe

• Gene Location: Start: 7621; End: 9210 Strand: +

Full Sequence      

MYRQTGNERLKAKADYIVEEIGRCQEANGDGWAFSIPEKYLYGLKRGRHFWACQYVCHKT
MMGLMDMYRFGGNKQALEILRGCAEWFHAFTDEIDRETMDQMMDDEETGGMMELWADLYQ
EDPDPRYLELMRRYERPRLTEAVLNGTDVLTNMHANATIPEIHGCARAYEVTGEERYRKV
VENYWELAVNRRGSFATGGQTDGESWTPPNRQSARLSDMNQEHCVVYNMIRLADYLYRWS
GKKEYHDYIEQNIYNGLFAQGFWQGRTLEGALEDHIPDTGIVCYYLPLAAKSTKKWGRRI
EDFWCCHGTSVQANAQYSRWIWYQDQDGIAVEQYLPSRMETVWNGKNVSITMEDSNLGGD
YLRIMEVAGTLDQRPEYWKKSLHITADQADFELRFRLPWWLRENAVLTIDGMDADYEVRN
GEGVIKRVWTDSIVEILLPCKLTAWPLADSPDCVAFLNGPVLLAGVDTDEVRLHGDKDNP
QSILTPSHEREWEHWKEDYRTVGQERNFCFKPLKNIGREMYTVYFPVEK

Enzyme Prediction     

No EC number prediction in MGYG000000032_05632.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	1	464	3.9e-131	0.8608349900596421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	8.51e-82	1	464	70	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.23e-56	1	526	78	568	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE99157.1	1.01e-151	2	528	85	620
QIB58295.1	3.22e-150	2	528	85	620
QMW77732.1	3.22e-150	2	528	85	620
QNF30959.1	5.62e-147	1	529	98	624
AIQ41972.1	2.95e-145	1	529	94	622

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	2.65e-44	1	464	99	560	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	1.06e-39	2	464	100	560	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	1.85e-09	154	488	247	563	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	5.17e-08	173	462	284	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	4.75e-07	173	462	284	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000032_05632.