CAZyme Information: MGYG000000032_05828

Basic Information

• Species: Hungatella effluvii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella; Hungatella effluvii
• CAZyme ID: MGYG000000032_05828
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
485	MGYG000000032_29|CGC2	56039.22	4.893

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000032	6969476	Isolate	United Kingdom	Europe

• Gene Location: Start: 35023; End: 36480 Strand: +

Full Sequence      

MSGFYKDFLWGGAIAASQADGAWNEGGKGIDTQDLRYFDAGWDWEKRQENRNINMTGERF
FAALQTGETEHYPFRRGIDFYHHYKEDLALMEELGLKLFRTSINWARIYPNGDDETPNEE
GIQFYTDLFTECHKRGMKVFATILHYNIPVNLVTKYGGWKNRKTIDFYVKYCKTLYERLG
ALVDYWLPFNEINCSRFNPWNGCCIIKDQEEHYEQTIFQCTHHQLLANALAVKAAHEILP
GSMVGGMIARFTSYPATCRPEDVMQTILDENYKNYFYTDVMARGRYPAYAKRMLREMGVS
IETEPGDEEILRDNTVDFLSFSYYMSMISSNDPNYEITSGNLLSGKKNPYLETSAWGWQI
DPLGIRISLNEMYDRYQLPLFIAENGLGAVDILEGESVHDSYRIAYLREHVKQMAEALDD
GVELLGYTMWGIIDIVSCGTIEMSKRYGVVYVDRGDAGEGTNRRYKKDSFEWYKRCIATG
GLVID

Enzyme Prediction     

No EC number prediction in MGYG000000032_05828.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	479	1.2e-131	0.9836829836829837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09852	PRK09852	0.0	1	481	1	470	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	0.0	1	483	1	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	4	481	6	474	6-phospho-beta-glucosidase; Reviewed
PRK09589	celA	4.28e-179	1	481	1	473	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	1.16e-153	6	481	8	474	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNV77993.1	8.76e-277	4	485	5	487
AHI54714.1	8.76e-277	4	485	5	487
AIS64182.1	8.76e-277	4	485	5	487
SNV33938.1	8.76e-277	4	485	5	487
QDA73294.1	8.76e-277	4	485	5	487

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	1.09e-176	4	481	8	466	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4IPL_A	2.55e-154	1	481	17	482	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
4F66_A	7.65e-144	1	481	4	477	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	2.17e-143	1	481	4	477	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
2XHY_A	8.44e-143	6	481	10	476	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	2.41e-175	4	481	8	466	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	5.02e-171	1	481	1	470	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q46130	1.45e-157	4	485	7	472	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P42973	9.35e-155	1	481	1	476	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P11988	1.77e-147	1	484	1	462	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000010	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000032_05828.