CAZyme Information: MGYG000000033_00228

Basic Information

• Species: CAG-41 sp900066215
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; CAG-41; CAG-41 sp900066215
• CAZyme ID: MGYG000000033_00228
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
879		95669.16	5.8557

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000033	3010191	Isolate	United Kingdom	Europe

• Gene Location: Start: 254218; End: 256857 Strand: -

Full Sequence      

MADNNRRNRPSSGYGSNDNFNWEEYDMKTSSASGAPRRRRQAASTKPTRSPQASSSSYRE
VPSRRRTQTTSRSKKKQKKQLTPKQIQFRKRLRLTFFVAIFVVVVIVSGMGIGMYAAVSR
EIKDMNIQTLALNYSSFIYYEDAAGNPQELEQIQSDFNRIWVDSSQIPQVMKDAIVSIED
ERFYKHHGVDIKRTLGATGKWVLSKVGIGSSNYGGSTITQQVIKNITNEKENTPSRKVKE
MMRAVALEKQLTKDEILTMYLNIVYFANNCNGVEAAANTYFNKDASDLTLAEAASIAGIT
QFPSEYDPFVHPDKNIEKRNLVLGKMRELGYITDAEYAEASGSDLVVSNAYRQNQGRITS
YFVDQVVNDVIADLMTQKGYSEDFATQQVYNGGLKIYSTMDPDIQNIMEGIFTNTSNFPY
TGKGAQSAMIIIDPYTGKIRGLIGGLGEKTDIRGWNRATQSKRQPGSSIKPLSVYAPAVD
MGKITEVDTVKDEEITIGNDKWKPKNSYNDFLGDMTIKEAVARSANIPAVKVLDMVNLTN
SFNYLQNKFHITTLEEKDKNYSSLALGGLTQGVTVEEMAGAYCTFVNSGKYIKPYTYTRV
LDSTGQVILENTSSTSQAISPAAAYITADLLSGVVNSSVGTGKGAKLDCGISTYGKTGTT
DDDCDKWFVGFTPYYVGACWYGFDNPASISAAGVSGNPTVTAWNLVMEKIHESLNPKEIT
KPSNVVEAQVCEYSGMLATDTCPTTTAYFVEGTQPKAYCDASHASRRNKPTQTPLSTVAP
VNTPSVMPTVNPATSETHENQNGNNSNTSSGINSGSSSSTNSGSSSSTNSGTNSGSYDTN
SGSSSSSNSGGTDYEQGNTGSSESENTAGGAEEDTSSEE

Enzyme Prediction     

No EC number prediction in MGYG000000033_00228.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	149	326	7.5e-64	0.9717514124293786

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	0.0	158	712	1	530	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	5.02e-169	158	785	75	660	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	3.76e-139	109	760	21	769	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG4953	PbpC	1.47e-94	159	757	58	604	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	5.30e-75	155	327	9	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUO18445.1	1.17e-168	124	717	42	640
ADU75447.1	1.17e-163	123	755	62	700
ANV77201.1	1.17e-163	123	755	62	700
ALX09447.1	1.17e-163	123	755	62	700
CBF97356.1	3.27e-163	123	755	62	700

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZG8_B	1.71e-85	247	695	3	450	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
7U4H_A	2.98e-83	146	758	27	810	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3ZG7_B	2.43e-80	247	695	3	450	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
4OON_A	3.69e-70	156	749	36	759	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3DWK_A	4.90e-64	162	725	30	602	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7FY32	1.47e-116	113	769	33	709	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
A5I6G4	1.47e-116	113	769	33	709	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1
A7GHV1	2.07e-114	113	769	33	709	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
Q891X1	5.44e-109	108	760	36	711	Penicillin-binding protein 1A OS=Clostridium tetani (strain Massachusetts / E88) OX=212717 GN=pbpA PE=3 SV=1
Q97GR5	1.85e-104	113	776	49	716	Penicillin-binding protein 1A OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
94	116