CAZyme Information: MGYG000000033_01470

Basic Information

• Species: CAG-41 sp900066215
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; CAG-41; CAG-41 sp900066215
• CAZyme ID: MGYG000000033_01470
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
578	MGYG000000033_10|CGC1	66359.01	4.9529

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000033	3010191	Isolate	United Kingdom	Europe

• Gene Location: Start: 6236; End: 7972 Strand: -

Full Sequence      

MSLYENTIKIYTQYDYELCDISNEANIKLLKLRLDFKEKINPEPVVIKFYVKSENVFAQW
SPTAEYIRNIRFDWSKAECKSSAAFGAPVQCLYGADGINSMTCAIADFKTPVSIKCGVCE
ENAAIEMDIEFFTCMTAKRSSYETIIRLDMRNIRIYDIMRDVSGWWRKSGNLPDMSVPDI
AKHPMYSTWYSYHQNIDTEAVVAECKKAYELGMRAVIVDDGWQTDNSERGYAYCGDWKPA
IKRIGDMKAFVDAVHSTGMKFILWYSVPFVGKYSEAWNKFKGKFLDSADNDYCVLDPRYR
EVRDYLTGIYENAVREWGIDGFKLDFIDSLRMTESSNEYNSEMDTEQLEDAIEKLLGDIL
KRLRAIKPDILIEFRQNYIGPLMQTYGNMLRASDCPYDALTNRMRTLDLRMMSGCGVVHS
DMLMWDMSGSAENAARQITNVLFSVPQISVKLNDIPAEHMEMLKFYLSFCDRYCDVLLEG
SLHVYQPEMLYSMAYAQKGNRAVAVDFSGVVWNIESGIDEAVYVNAAQKDALYINAENID
GTYDILNCRGKIIEKGTLLRNTLKKFNVPVSGMIIIRR

Enzyme Prediction     

No EC number prediction in MGYG000000033_01470.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	184	505	1.5e-34	0.48255813953488375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	1.08e-62	184	469	4	296	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam02065	Melibiase	1.28e-12	188	373	47	236	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd06592	GH31_NET37	4.54e-10	182	347	1	172	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
cd14792	GH27	4.78e-08	184	354	2	147	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
COG3345	GalA	5.54e-08	184	373	293	481	Alpha-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMV40951.1	1.74e-166	13	576	18	585
QSF42796.1	1.28e-156	24	577	31	589
AZN41080.1	1.81e-155	22	576	32	597
QJD86820.1	1.99e-155	16	576	20	600
QTH41069.1	2.80e-153	22	576	29	588

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2YFN_A	1.72e-06	185	373	332	516	galactosidasedomain of alpha-galactosidase-sucrose kinase, AgaSK [[Ruminococcus] gnavus E1],2YFO_A GALACTOSIDASE DOMAIN OF ALPHA-GALACTOSIDASE-SUCROSE KINASE, AGASK, in complex with galactose [[Ruminococcus] gnavus E1]
4FNR_A	6.85e-06	185	334	332	485	Crystalstructure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000082	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000033_01470.