CAZyme Information: MGYG000000033_01471

Basic Information

• Species: CAG-41 sp900066215
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; CAG-41; CAG-41 sp900066215
• CAZyme ID: MGYG000000033_01471
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
720	MGYG000000033_10|CGC1	83305.41	5.8647

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000033	3010191	Isolate	United Kingdom	Europe

• Gene Location: Start: 7975; End: 10137 Strand: -

Full Sequence      

MFEKISFIKPDIPFDKNKFYAPMFRKKFVLSETVKSAKLNICGLGYAYVWLNGKKITQDL
FTAPVSNYSKTLWYNTYDVTNLLNKGENILAVICGCGWYNEGIESAWDYDKAKWRDNPKF
IMRLDVNGSTAVKSDSTWKCSIDSPATYNQLRCGEHFDSRLYAENWTEYNFDDSKWSAAA
EDNTPPKGAFRPCECEPIRECGVLPAKAMYKSGDDKYVFDIGQNISGYIRLHTNQTGGDK
IIIRYAEEINEDYSLQLNDMEKYYPSSPFQTDEFICCGKDFVWSPIFVYHGFRYIEISGI
KNPSLNDVSGVFVHQAVKTRTGFECSDERINKLFKAGQNATLSNLFYMPTDCPTREKLGW
ANDAQSSTEQMLINFETERVFEKWLTDIHDAMREDGALPGIIPTAGWGYHWGNGPVSDGV
LFEIPYRLYLHTGNKKPLTDSIPYFKRYLDYLDMQEDKDGNLNFGLDDWAAPDNDDKVDS
VFINALLKIKFIRILLLAQELDGMNTDEIKLKEQYAVRRVKEKYLTNGRCSVNKQTAAAM
LIYFDIYDDFELLKKQLKELVEQKNFHHDCGMVGLRYLYRALSKCGLQEYAYKIITAEGF
PSYINWLNNGATTLYERWNMTESKNHHMYSHFMAWLMTDIIGIQPDNTNGYRIDIKPYYV
KELSYVRGYYSTEYGRITVEWKRENGAVNLCVEVPQNVNATYNGQKLRTGENKFIIKEQI

Enzyme Prediction     

No EC number prediction in MGYG000000033_01471.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	211	701	3.6e-120	0.9880952380952381
CBM67	21	182	7.5e-32	0.8636363636363636

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.06e-66	320	636	2	336	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.08e-42	34	199	3	169	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	8.34e-23	211	314	2	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	8.75e-12	642	701	1	60	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ94103.1	7.28e-147	21	711	143	853
AHF16194.1	3.51e-141	21	715	172	874
AYB33152.1	7.71e-132	22	702	185	874
QGA23306.1	1.43e-131	15	701	155	859
QMW03094.1	1.33e-127	21	717	157	877

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.95e-95	20	718	175	909	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.11e-71	21	700	302	990	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	9.40e-63	8	701	117	843	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	3.57e-82	13	700	176	902	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	1.87e-76	25	714	178	893	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	4.50e-76	25	702	174	876	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
Q82PP4	5.45e-71	21	700	302	990	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000033_01471.