CAZyme Information: MGYG000000033_02453

Basic Information

• Species: CAG-41 sp900066215
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; CAG-41; CAG-41 sp900066215
• CAZyme ID: MGYG000000033_02453
• CAZy Family: PL11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1093		121753.69	4.3617

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000033	3010191	Isolate	United Kingdom	Europe

• Gene Location: Start: 7005; End: 10286 Strand: -

Full Sequence      

MKMKKNKIRVISAVVSAIMLASSASAFAKFDAYNDSDGFTLGHYEAEVNQEQRADTEKLY
EQRPKNERQFENLSRGLVAVPGENGTLVSWRFLGTDSNSLTYNLYCSGEKLNDKPINTTN
FFHTGAGANAEYTLKEVENGEETGVEYTTTAWDKNYIGFKVTEREGYNIDDGAVADLDGD
GEYEILLRRVPSMDVNTRTSYPVIEAYKTDGTHMWTIDIGPNEINEVDINFLAYDMDGDG
KAEVIMRSFEGTTDGKGNTTGDTNGDGITDYSKSESNLAIFKDRQYIVSTPEFLSIYDGE
TGEETDRTDLKPSKEPLSDWSYRYSDTGRLTKRASHYLFGLAYLDGVTPSVVMVRGAWDN
VRAAAWHIEDGKFKEDWVHNTENKDDVNSIWGACNHNLVTVDVDFDGKDEILSGPMAIDH
DGSEMYAVKVYDNDGNAQKLAHGDAFDVAKTDPDFNGYMTWACHETSQLMANIEYHDART
GEVQWGYSKNKDTGRSRSADIDPTHKGFEVWGSTATIPANISGENIADTWNGFKFRKIDG
TVDSDATIPMNFKVYWDGDLLSELLDGTTVSKYNWEDKSVDVLMTADDCASNSGTKAVPC
ISADLFGDWREEIVWKTADEKEIRIYSTSIPTSYKLNTLMHDSYYRASVAVQNNHYNQPP
NLSYYLGAETTKVPMFEGYVIKDGKKITNPDLTGSHGTYDINAKTGALSVKLAVDCANAY
VGNNIVQIDTENSDVTPIIVDDRTLVPVRFIAESLGMDVGYNDSTRTVTLSGNGYKVNMT
LDKSEYTINDIPFEMDVPAQVVNDRTLIPLRVIAESIGKKVEWDADNRLIYIGSVQFYDK
ANAAKYAAALKNGKEEDQEIIETPVPTEEPDLLATADYTEYTDYNNIAWKMYINEDYEKY
NIGDKLEWAGTKKPGELANIAVAQGTNGKVMHFEDSTKGNRNAIYNLPYKMNDTVRIELD
WKVGECTGGQSYGELRFADSSKNTFFALKTQKGAELQYSANGGIANGLLETDWKDVGTGF
NKDTVYNVVIEADFDKKVCNATISDGSKTAKITDMPFENATDFNAMEVLAVRVEKNFTWA
TDIDNMKVGIKAN

Enzyme Prediction     

No EC number prediction in MGYG000000033_02453.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL11	68	673	1.9e-176	0.9862778730703259

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10318	RGL11	0.0	71	664	2	564	Rhamnogalacturonan lyase of the polysaccharide lyase family 11. The rhamnogalacturonan lyase of the polysaccharide lyase family 11 (RGL11) cleaves glycoside bonds in polygalacturonan as well as RG (rhamnogalacturonan) type-I through a beta-elimination reaction. Functionally characterized members of this family, YesW and YesX from Bacillus subtilis, cleave glycoside bonds between rhamnose and galacturonic acid residues in the RG-I region of plant cell wall pectin. YesW and YesX work synergistically, with YesW cleaving the glycoside bond of the RG chain endolytically, and YesX converting the resultant oligosaccharides through an exotype reaction. This domain is sometimes found in architectures with non-catalytic carbohydrate-binding modules (CBMs). There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain through a beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
pfam18370	RGI_lyase	8.12e-34	68	152	1	86	Rhamnogalacturonan I lyases beta-sheet domain. This is the beta-sheet domain found in rhamnogalacturonan (RG) lyases, which are responsible for an initial cleavage of the RG type I (RG-I) region of plant cell wall pectin. Polysaccharide lyase family 11 carrying this domain, such as YesW (EC:4.2.2.23) and YesX (EC:4.2.2.24), cleave glycoside bonds between rhamnose and galacturonic acid residues in RG-I through a beta-elimination reaction. Other family members carrying this domain are hemagglutinin A, lysine gingipain (Kgp) and Chitinase C (EC:3.2.1.14).
pfam07833	Cu_amine_oxidN1	3.62e-32	740	832	1	93	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
pfam07833	Cu_amine_oxidN1	6.38e-12	701	770	29	93	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACL75117.1	9.89e-144	68	692	31	624
AAG45161.1	3.10e-136	68	692	31	625
AJW86197.1	3.53e-136	68	674	34	607
ADM36775.1	3.53e-136	68	674	34	607
QCJ16062.1	4.24e-136	68	674	40	613

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Z8R_A	1.01e-135	68	676	3	581	Crystalstructure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8R_B Crystal structure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8S_A Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2Z8S_B Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2ZUX_A Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis],2ZUX_B Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis]
4CAG_A	2.91e-131	68	667	9	576	Bacilluslicheniformis Rhamnogalacturonan Lyase PL11 [Bacillus licheniformis]
2ZUY_A	1.58e-124	68	674	6	597	Crystalstructure of exotype rhamnogalacturonan lyase YesX [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31526	1.34e-134	68	676	40	618	Rhamnogalacturonan endolyase YesW OS=Bacillus subtilis (strain 168) OX=224308 GN=yesW PE=1 SV=1
O31527	6.81e-124	68	674	6	597	Rhamnogalacturonan exolyase YesX OS=Bacillus subtilis (strain 168) OX=224308 GN=yesX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000558	0.998579	0.000287	0.000207	0.000183	0.000165

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000033_02453.