CAZyme Information: MGYG000000034_02068

Basic Information

• Species: Massilimaliae timonensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Massilimaliae; Massilimaliae timonensis
• CAZyme ID: MGYG000000034_02068
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
809		93815.56	4.5463

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000034	2753532	Isolate	United Kingdom	Europe

• Gene Location: Start: 221999; End: 224428 Strand: +

Full Sequence      

MVRQKLHHGWSMQISGETEQIPAIVPGSVYNDLLENGKMKDPFWRDNEMEALKIMDHDFI
YTTTFTAEEGIRESEQVLLHCDGLDTICDVFLNGTLLGYANNQHRVWEFDVTDLLDEENE
LKIVFYSPTKYIKEEQKKIIVDGSEHAMVGFPHIRKAHCMFGWDWGPRLPDAGIWRDIVL
LGINEARIDSVYITQRHKNGAVDLELDVDADVICDDAELSYTVTLTAPDGTVSSYQDSPE
TISVENPQLWWPNGYGAHPLYTVRVDLFADGEMVDTWEKRIGLRTMTMHIEKDEYGESFA
HEVNGVQIFAMGGDYIPEDNIFSRITPERTRKLLKQCVAANYNSIRVWGGGYYPDDWFYD
ACDELGLVVWQDMMFACAVYELTEDFEENIHQELIDNIKRLRHHASLGLWCGNNEMEMFV
DQWEWVTTHKQKADYIKMYEYLFPKILKEYDPNTFYWPASPSSGGSFDNPNDPNRGDVHY
WEVWHGNKPFTDYRNFYFRYASEFGFQSFPCEKTVESFTLPEDRNIFSYVMEKHQRNNSA
NGKIMNYMYQTYLYPTEFGTLLYASQMLQAEAIKYGVEHWRRNRGRCMGAIYWQLNDCWP
VASWASVDYFGRWKALHYYAKRFFAPLMLSCCEEGTLSQEPNVNAECQDIEKSIRLNVAN
ETMQEQTVTVRWALRKNDSSVLKSGEEVVTVPALQSLWLEKICFPEADIHTQYASYEMEQ
DGNVISSGTVLFCAPKHFQFLDPQITVAVDGNELVVTAKQYAKGIELFNENEDWVLEDNY
FDMNAGTRRIKIISGAPVGIKVRSVFDIR

Enzyme Prediction     

No EC number prediction in MGYG000000034_02068.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	699	1.4e-106	0.6875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	8.19e-95	1	630	10	635	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	1.47e-16	60	415	112	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam17786	Mannosidase_ig	3.15e-13	654	737	3	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam00703	Glyco_hydro_2	3.49e-12	186	284	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10150	PRK10150	2.32e-10	9	285	33	277	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEF82182.1	0.0	1	809	1	816
QBE97789.1	0.0	1	809	15	837
QIB54534.1	0.0	1	809	1	823
QMW79049.1	0.0	1	809	1	823
QJU13790.1	0.0	1	809	1	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	2.54e-152	1	804	3	834	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	2.62e-152	1	804	3	834	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	1.87e-151	1	804	1	832	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	1.92e-151	1	804	3	834	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	1.40e-142	6	797	11	819	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8NW36	1.23e-118	6	799	9	833	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
Q0CCA0	1.68e-118	3	795	6	828	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q2TXB7	1.73e-118	6	799	9	833	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
A1CGA8	1.77e-118	3	634	6	663	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
Q4WAH4	3.46e-118	6	799	9	834	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000034_02068.