CAZyme Information: MGYG000000035_02626

Basic Information

• Species: Blautia_A hydrogenotrophica
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A hydrogenotrophica
• CAZyme ID: MGYG000000035_02626
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
503		56823.42	10.128

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000035	3529525	Isolate	United Kingdom	Europe

• Gene Location: Start: 28838; End: 30349 Strand: +

Full Sequence      

MKKFVKRVLSIVLAAAVLATSVTLPQTAQDVQAASSKAWKKSGGKCYNGKGQVIPGAKTR
GIDVSEWQGNIDWDKVAKSGVDYAFIRVGGYGNGSYQREDKTYRANIRGANAAGIPVGVY
YYSTAKTTAQAKKDAQYVVKMITGHKISYPVVFDMEDATVEYLSPSTKSKIADAFLSEIK
RAGYYPMIYTNLNWYNNEFNMSMLAGYDVWIAQYNSNSTGPSKSDYRYTIWQATDGSSIG
PTTAGMISGIPRENAVDLNFGYVYYLSKITPRTQPVAGYDPDGTVKNGWVEQNGKYYYYD
HGTLYKNKLFKVNGKIYYVDGTGARQYGWQTINGKKRYFYYRTGYAATGWIPIQKKYYYF
SKVDGMLYTNKLFVSSSGKTIYYSDENGVRVKNQLISATYKGVKRAYYFGSNYKAVTGWF
KHKGGKYYALPTTHGVVRNGIRKIGSKYYGFGQYGRMLTGFQRIDGKLYFFHKTSGVQYR
NRTEHWSGKNYIFDKNGVCTVRK

Enzyme Prediction     

No EC number prediction in MGYG000000035_02626.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	62	238	1.7e-47	0.9717514124293786

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	4.19e-75	60	262	2	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	4.50e-36	60	259	1	184	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	1.28e-29	62	240	1	178	Glycosyl hydrolases family 25.
cd06525	GH25_Lyc-like	3.69e-24	60	260	1	183	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd06523	GH25_PlyB-like	1.00e-21	62	259	3	175	PlyB is a bacteriophage endolysin that displays potent lytic activity toward Bacillus anthracis. PlyB has an N-terminal glycosyl hydrolase family 25 (GH25) catalytic domain and a C-terminal bacterial SH3-like domain, SH3b. Both domains are required for effective catalytic activity. Endolysins are produced by bacteriophages at the end of their life cycle and participate in lysing the bacterial cell in order to release the newly formed progeny. Endolysins (also referred to as endo-N-acetylmuramidases or peptidoglycan hydrolases) degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCU01355.1	3.90e-105	35	501	58	507
ASM68843.1	5.47e-51	38	308	73	329
QCT06313.1	3.23e-42	35	262	59	283
QMW70654.1	9.92e-42	36	260	71	278
BCD36477.1	9.92e-42	36	260	71	278

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4KRU_A	5.10e-16	60	245	21	201	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	6.05e-16	60	299	21	268	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
3HMC_A	2.74e-11	62	239	8	168	Endolysinfrom Bacillus anthracis [Bacillus anthracis]
2WAG_A	8.87e-10	60	262	17	207	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]
4NBX_A	2.61e-09	328	452	8	133	ChainA, TcdA [Clostridioides difficile]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26836	6.16e-11	60	265	10	210	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2
Q8FFY2	6.66e-09	54	253	61	260	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
P76421	3.88e-08	54	253	61	260	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8X7H0	1.25e-07	54	259	61	252	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
P25310	2.65e-07	60	240	83	268	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000200	0.999169	0.000159	0.000176	0.000146	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000035_02626.