CAZyme Information: MGYG000000037_00582

Basic Information

• Species: Turicibacter sp001543345
• Lineage: Bacteria; Firmicutes; Bacilli; Haloplasmatales_A; Turicibacteraceae; Turicibacter; Turicibacter sp001543345
• CAZyme ID: MGYG000000037_00582
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
526	MGYG000000037_5|CGC2	59455.32	6.1313

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000037	2730783	Isolate	United Kingdom	Europe

• Gene Location: Start: 92285; End: 93865 Strand: +

Full Sequence      

MKINLLFTSSTSALFELENDEIVQTLTPYTILINDKIYKKHGHDNVFSIYDLTPNTTYQL
TLIEESSNQSTQLNFTTNEEYVCLNVTRFNAKGDGIADDTLAIQTAIMSCPVNGRVLIPK
GTYRVKTIFLKSNLTLEFEKGARLLYDVTPESGAILPGYLTTQNHDEYYLGSWEGNPLDT
FTALIQGINVSNVKIIGEGILDGNANSDWWKYPKNKRGAWRPRLFQLINCEQISVQGMTF
TNSPSWTIHPLWSKDLIFADLKIINPKDSPNTDGLDPESCENVLIVGVYFSVGDDCIAIK
SGKIYLGRRLKRASKNICIRNCSMNFGHGAVVIGSEMAGGVNNILVERCLFNETDRGLRI
KTRRGRGRDAVIEKIKFSKIKMTKVISPLVINSFYFCDPDGHSDYVKTKETLVVDDRTPL
IRDCDFEKLYCMDCEAVAGYFYGLPEQPIEKIKLTDCHFSFNKEALPSYPAMMDDIRMYC
KEGLIMTNVNEVELKHLTFEGIKGEELVLKQIKKVVTEDVIKKIDC

Enzyme Prediction     

No EC number prediction in MGYG000000037_00582.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	106	465	2.3e-75	0.9323076923076923

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	2.17e-97	84	504	83	520	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	8.43e-30	185	395	48	250	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN02218	PLN02218	2.16e-27	76	400	60	359	polygalacturonase ADPG
PLN03003	PLN03003	3.11e-27	84	415	24	318	Probable polygalacturonase At3g15720
PLN02793	PLN02793	8.96e-27	84	398	53	342	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJS20091.1	1.37e-251	1	526	1	526
ARE86445.1	9.80e-185	1	515	1	517
AOY76083.1	9.80e-185	1	515	1	517
ABX43097.1	1.02e-183	1	518	1	518
ABR47121.1	1.21e-182	1	513	1	515

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	1.28e-43	84	367	28	335	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
5OLP_A	5.29e-30	86	456	47	422	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
2UVE_A	4.18e-25	18	409	83	514	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]
1BHE_A	1.12e-20	100	395	26	314	ChainA, POLYGALACTURONASE [Pectobacterium carotovorum]
1HG8_A	6.54e-06	188	385	66	267	Endopolygalacturonasefrom the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27644	3.60e-54	223	477	23	279	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
A7PZL3	1.99e-37	89	456	68	421	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
Q9LW07	2.18e-27	84	415	24	318	Probable polygalacturonase At3g15720 OS=Arabidopsis thaliana OX=3702 GN=At3g15720 PE=3 SV=1
P15922	2.18e-25	66	409	134	507	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1
P58598	9.97e-22	99	395	74	401	Polygalacturonase OS=Ralstonia solanacearum (strain GMI1000) OX=267608 GN=pglA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998929	0.001125	0.000003	0.000003	0.000001	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000037_00582.