CAZyme Information: MGYG000000037_01039

Basic Information

• Species: Turicibacter sp001543345
• Lineage: Bacteria; Firmicutes; Bacilli; Haloplasmatales_A; Turicibacteraceae; Turicibacter; Turicibacter sp001543345
• CAZyme ID: MGYG000000037_01039
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
804		91653.32	4.7927

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000037	2730783	Isolate	United Kingdom	Europe

• Gene Location: Start: 49854; End: 52268 Strand: -

Full Sequence      

MKKHPKYLRVINTLICMCILISHLQDLVIVANASIIDSSNSTLTEISDGELNESTQESED
SFNIVENNESNSTFIEEEINEEELPSQEAIDIDDVSINDEIDLEIQQEETESIVAESIDL
VSEHTESRSAGSGLVQFKVEGTTTCGYNHNLYPNRGKSEHATYINSCYVNDALYLGEDSD
YYYIYISGYEGKVLKEERQGNVRIIAEYIPANPVRTASLGLEEAEVLDVPYLNYADQTLN
EKEKAISLASTGTVQSPSYYANEGGTLVHYITKNVTIDRNYSKIIVGLAPEWMQQGYKYY
SYDGIYFYNSWQNIRVNGHGAINENSPFYNYYQYLSFRSNSNYNAQTLDNYTNNNGGSGG
KLVNTGQYFNAVRNKYGVNGTLQYVMGIHESGWGKSSIAMNKNNLFGINATDSNPGQDAN
QFKSVEDCIYTHAQRYISWGYTDPLDDWRYFGAHVGNKGSGMNVKYASDPFWGEKVAGWY
YRLDQANGMKDYNSYIIGVKTANKVVNVYSSNNTSSKVLYQTKNKKSNLKIADYPFLILG
EEGGFYKVQTDTPIVNGYPSYSATYNWNNSKGYISKESINYTSKSLNGWIIDQGHKYYYE
NGKKVTGWLQLNNKWYYLNAKGIMQTGWLQLNNKWYYLNELGEMQTGWLTLNGKTYYLNP
SGKMHSGWLYDNEKWYYFWDSGSLAKGWVECPDGWYYLNELGEMQTGWLTLNGKTYYLNP
SGKMHSGWLYESGNWYYFWDSGGLAKGWIEQPEGWYYTNSSGIMQRGWQTIGGKKYYFYS
SGLMASRTTIDGYIIDENGVATKK

Enzyme Prediction     

No EC number prediction in MGYG000000037_01039.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	366	482	1.9e-19	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033930	pneumo_PspA	4.49e-71	588	799	444	657	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	2.64e-65	606	799	486	680	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033930	pneumo_PspA	7.75e-52	625	792	442	609	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	2.16e-45	541	724	491	665	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033840	PspC_relate_1	8.55e-38	666	799	510	644	PspC-related protein choline-binding protein 1. Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMC08108.1	0.0	31	625	2	596
QJS18969.1	1.79e-199	36	615	51	678
AMC08779.1	1.58e-106	134	579	162	574
QJS18990.1	2.60e-104	134	579	158	574
ALG48000.1	1.33e-76	134	625	155	626

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4Q2W_A	3.70e-21	259	491	88	290	CrystalStructure of pneumococcal peptidoglycan hydrolase LytB [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P59205	1.46e-20	259	491	456	658	Putative endo-beta-N-acetylglucosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=lytB PE=1 SV=1
P59206	1.62e-20	259	491	500	702	Putative endo-beta-N-acetylglucosaminidase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=lytB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.066960	0.927251	0.004749	0.000340	0.000306	0.000356

TMHMM  Annotations     

start	end
7	29