CAZyme Information: MGYG000000037_01319

Basic Information

• Species: Turicibacter sp001543345
• Lineage: Bacteria; Firmicutes; Bacilli; Haloplasmatales_A; Turicibacteraceae; Turicibacter; Turicibacter sp001543345
• CAZyme ID: MGYG000000037_01319
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
196	MGYG000000037_16|CGC1	23071.38	4.4634

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000037	2730783	Isolate	United Kingdom	Europe

• Gene Location: Start: 23659; End: 24249 Strand: +

Full Sequence      

MSQMIPKIIHQIWIGDSEIPKQCLQYIDSWKKHHSDWEYRLWTDENMIKLQNQELYDSTT
NIRQKADIARYELLYRFGGVYVDIDMECFKNIEPLLDGVEFFVGTEDDFYFSNELMGCVP
YHELMCELVEGIPASIKSDYNLTIDEQSGPIYITKYLLWMPQVTVVEQEIFFPEQSCQAN
LKKSYAAHRAKLLASL

Enzyme Prediction     

No EC number prediction in MGYG000000037_01319.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	23	97	3.3e-21	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	3.30e-27	3	122	80	204	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	7.26e-17	20	102	1	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam12919	TcdA_TcdB	1.29e-06	7	46	1	39	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.
pfam05704	Caps_synth	1.10e-05	4	103	45	151	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMC09421.1	1.67e-147	1	196	1	196
QJS19836.1	1.34e-85	1	191	1	192
QFR95457.1	6.07e-33	5	188	3	203
CCA16270.1	2.94e-32	5	132	79	210
CCA15666.1	2.94e-32	5	132	79	210

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O14084	1.60e-22	3	158	62	231	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
Q10323	1.75e-20	2	159	54	215	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
P38287	1.25e-17	3	154	60	217	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
Q9UT67	4.95e-17	4	159	81	240	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
P33300	5.74e-16	3	159	53	213	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000037_01319.