CAZyme Information: MGYG000000037_01475

Basic Information

• Species: Turicibacter sp001543345
• Lineage: Bacteria; Firmicutes; Bacilli; Haloplasmatales_A; Turicibacteraceae; Turicibacter; Turicibacter sp001543345
• CAZyme ID: MGYG000000037_01475
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476	MGYG000000037_19|CGC1	55023.51	5.5958

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000037	2730783	Isolate	United Kingdom	Europe

• Gene Location: Start: 13570; End: 15000 Strand: -

Full Sequence      

MNQLPKEFLWGGAVAAHQVEGGYNKGGKGISIVDVLTGGAHGIDRVITDSIEEGKYYPNH
EAVDFYGHYKEDIALFAELGFKCFRTSIAWTRIFPKGDELEPNEEGLRFYDDLFDELLKY
NIEPVITLSHFEMPYHLVKEYGGWKNRKVIDFFVRYSEVVMKRYKDKVKYWMTFNEINNQ
KNYKYPLFGYTCSGVIFNHHENPEQCMYQVVHHQLVASAKVVALGHQINPNFQIGCMMAC
VPLYPYSCKPEDMMYSVESMHDRYLFSDVHVRGEYPTYAIKEWERKGFNIDMEPEDKEIL
KNGTVDYIGLSYYMTNAVKADNVVEGNGLSGFPGSVPNPHVKSSDWGWQIDPIGLRYALN
LLYERYQKPLFIVENGFGAIDTVEEDGSINDDYRIDYLKAHIEEMKKAVVLDGVDLMGYT
PWGCIDCVSFTTGEYKKRYGFIYVDKHDDGTGTMKRMKKKSFNWYKKVIETNGEEL

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	473	2.9e-152	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	476	1	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	1	476	1	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	4	476	6	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	1	475	1	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	4	476	6	477	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMC08922.1	0.0	1	476	1	476
QJS19178.1	0.0	1	476	1	476
QUO31522.1	4.71e-304	3	476	4	477
ACQ93096.1	1.91e-303	2	476	3	477
AMH02055.1	2.70e-301	2	476	4	478

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XHY_A	7.05e-287	4	476	8	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	6.58e-234	1	476	4	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.88e-233	1	476	4	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	7.51e-226	2	476	5	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]
3QOM_A	3.28e-208	4	476	11	480	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46829	3.86e-286	4	476	8	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P42973	3.91e-244	1	476	1	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P40740	5.42e-194	2	476	6	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	3.35e-179	1	476	1	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q46130	1.41e-175	4	476	7	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000037_01475.