CAZyme Information: MGYG000000037_02479

Basic Information

• Species: Turicibacter sp001543345
• Lineage: Bacteria; Firmicutes; Bacilli; Haloplasmatales_A; Turicibacteraceae; Turicibacter; Turicibacter sp001543345
• CAZyme ID: MGYG000000037_02479
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315		35340.82	6.4932

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000037	2730783	Isolate	United Kingdom	Europe

• Gene Location: Start: 3307; End: 4254 Strand: -

Full Sequence      

MLIVALDGSGDFQSIQAAIDSLKGKDPTTIFIKRGVYHEKLYLNHSHVTFIGEDAESTVI
TFDDYAKKVLADGTLLQTFRSYTMFIHGNHLTFSNLTFENKSGKGKDVGQAIALYVDGDC
IHFKDCCFLGNQDTLFTAPLPSTPVIPGSFIGPGEYFPRKVGRHYYERCYLQGDIDFIFG
GATAYFERCTIFSNAIDGLSYVTAASTPKDEAYGYVFNHCELVSDARKGSVFLGRPWRRF
AHVAFLNCYLGPHIHAAGWDDWGKIDSHDSIKFYEFQNFGPGAKSNQRVNFSKELSPEEA
VFYKKEKVLGNWDPN

Enzyme Prediction     

No EC number prediction in MGYG000000037_02479.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	3	309	1.8e-93	0.9826388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	2.87e-71	1	312	83	405	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02773	PLN02773	7.19e-63	1	300	6	287	pectinesterase
pfam01095	Pectinesterase	1.84e-55	3	300	3	286	Pectinesterase.
PLN02432	PLN02432	2.66e-54	1	311	12	289	putative pectinesterase
PLN02682	PLN02682	4.76e-52	8	300	78	352	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMC07926.1	1.65e-245	1	315	1	315
QJS17892.1	3.67e-150	1	314	1	312
ADZ82949.1	1.70e-114	2	314	1	320
ACZ98654.1	2.85e-114	2	314	1	321
QEH68466.1	1.96e-113	2	314	1	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	1.30e-33	3	312	6	303	ChainA, Pectinesterase 1 [Solanum lycopersicum]
3UW0_A	1.17e-28	3	312	34	361	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
1GQ8_A	1.46e-28	2	291	9	281	Pectinmethylesterase from Carrot [Daucus carota]
1QJV_A	1.55e-27	12	314	18	339	ChainA, PECTIN METHYLESTERASE [Dickeya chrysanthemi],1QJV_B Chain B, PECTIN METHYLESTERASE [Dickeya chrysanthemi]
2NTB_A	1.55e-27	12	314	18	339	Crystalstructure of pectin methylesterase in complex with hexasaccharide V [Dickeya dadantii 3937],2NTB_B Crystal structure of pectin methylesterase in complex with hexasaccharide V [Dickeya dadantii 3937],2NTP_A Crystal structure of pectin methylesterase in complex with hexasaccharide VI [Dickeya dadantii 3937],2NTP_B Crystal structure of pectin methylesterase in complex with hexasaccharide VI [Dickeya dadantii 3937],2NTQ_A Crystal structure of pectin methylesterase in complex with hexasaccharide VII [Dickeya dadantii 3937],2NTQ_B Crystal structure of pectin methylesterase in complex with hexasaccharide VII [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	7.63e-52	1	300	6	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9ZQA3	5.65e-43	1	300	90	370	Probable pectinesterase 15 OS=Arabidopsis thaliana OX=3702 GN=PME15 PE=2 SV=1
Q9FM79	5.00e-41	1	311	81	375	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q9SIJ9	5.39e-41	1	313	50	330	Putative pectinesterase 11 OS=Arabidopsis thaliana OX=3702 GN=PME11 PE=3 SV=1
Q9ZQA4	3.74e-40	1	301	41	319	Putative pectinesterase 14 OS=Arabidopsis thaliana OX=3702 GN=PME14 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000037_02479.