CAZyme Information: MGYG000000038_02153

Basic Information

• Species: Dorea_A longicatena
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Dorea_A; Dorea_A longicatena
• CAZyme ID: MGYG000000038_02153
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1119	MGYG000000038_10|CGC4	126159.86	5.5762

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000038	3124256	Isolate	United Kingdom	Europe

• Gene Location: Start: 82704; End: 86063 Strand: -

Full Sequence      

MKKKFVAICISLAITLTGPGMSMVTMTYADEITKENQQDQEISNDQNNTKDGENSNTNDG
KETENDLIQGNDSDSPQEKAEENITEEESKEDNMEAQQEEPSEETDSEETDSEEAVTQRK
VLNINDGWNFSTNDTSTAGWNFPSGAGNGVVNLPHSWEYVHPRQSYIPQMNSKTVTYEKT
VNISEIKNKNLFIKFYGAARNTEVFIDGEKVGTHVGGYSAFVFDITNYVQGKDEITIKAN
VTNIDTVSIPINVDYTQWGGIYRDVELISTDDQYISLEDYGNKGIYIDSNVNGTTADVNV
KNEISNKSNDDKELKIVTDIYDADGNKVTGTEQKVTAKANKNVQPYSTKCQIDNVHLWNG
TKDPYLYTANVTVYNENDEVLDTVSDNFGVRTYEIKNGKFYLNGQEYEIHGVGMHQDREG
YGNAVPDDLKVQDMNLMQEMGVNAIRTSHYPHSQSTYNLADERGMLVYCEIPYYLLLSNA
ESYKTSIKEELKEMIRQGYNHPSIMMWGIENEVYQPASAAAFGKDFQINENTLVSFNSSV
AKLAQKEDTTRYIVQAQIDSSNANKVCAKWSKNGNVDYTGVNLYVGFKSSVSSADDEGRK
EITDTLNRKLNEYKQTYNASSMMITEYGAGANINQHATMDENFSWSSDDASKDKHYEEYQ
AFVLETYYSLIQKRKDIPVSFVWNMFDFSCYRNEGGIPRRNTNGLVCYDHTTKKDAFYFY
KANWNQQDKFVYLTSKRYTERDTKYQQIKVYSNCEGVELFVNGQSVGKGRKQQSGVFVWD
DVKLDDMNTIKAVGTSDGQTYSDEVSGIKAENKNSATSIKYQTHIQSIGWQEAKKDGQTS
GTIGKGLRMEALKVKLQNKKYGGNIEYRTHIAQKGWQDWKKNGQTAGTTGEKLAMEAVRL
KLTGELAEHYDIYYRVHSQSYGWLGWAKNGEIAGTAGLAKRMEAIQIKLVEKGGKAPGTS
EKHYVSNQGVFYQSHVQTYGWQTWKQNGETSGTSGQAKRLEAIKIKLQKMKVSGNIEYQS
HVQTYGWEKSWKKNGQLSGTSGKAKRLEAVKIRLTGEMKNKYDVYYRVHAQSYGWLGWAK
NGEKAGTEGLAKRLEAVQIVLVEKGGAAPGSTEKTFIKK

Enzyme Prediction     

No EC number prediction in MGYG000000038_02153.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	99	801	3.6e-92	0.6928191489361702

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	9.77e-61	119	725	10	593	beta-D-glucuronidase; Provisional
COG3250	LacZ	4.94e-59	112	517	3	411	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	1.38e-40	166	553	103	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02836	Glyco_hydro_2_C	3.80e-28	394	725	2	299	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK09525	lacZ	9.71e-22	260	512	208	462	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXR42332.1	2.62e-279	116	831	81	810
BAQ97096.1	2.08e-277	116	843	66	791
AMC08061.1	1.37e-195	178	830	2	645
QFK71524.1	9.51e-117	119	814	2	659
AIQ56230.1	1.93e-112	119	822	2	664

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FN9_A	2.45e-97	119	814	5	670	Crystalstructure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_B Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_C Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_D Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343]
6MVH_A	6.48e-94	119	820	25	667	Crystalstructure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis],6MVH_B Crystal structure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis],6MVH_C Crystal structure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis],6MVH_D Crystal structure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis]
5Z1A_A	1.17e-93	115	805	19	670	Thecrystal structure of Bacteroides fragilis beta-glucuronidase in complex with uronic isofagomine [Bacteroides fragilis NCTC 9343]
3CMG_A	1.62e-93	151	805	28	651	Crystalstructure of putative beta-galactosidase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
6MVG_A	6.31e-89	119	782	25	633	Crystalstructure of FMN-binding beta-glucuronidase from Ruminococcus gnavus [[Ruminococcus] gnavus],6MVG_B Crystal structure of FMN-binding beta-glucuronidase from Ruminococcus gnavus [[Ruminococcus] gnavus],6MVG_C Crystal structure of FMN-binding beta-glucuronidase from Ruminococcus gnavus [[Ruminococcus] gnavus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ7	1.36e-64	151	829	82	741	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P77989	1.94e-46	119	509	3	384	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
A7LXS9	7.08e-41	116	804	39	732	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
P26257	6.42e-38	119	509	2	385	Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=lacZ PE=1 SV=1
Q9K9C6	5.13e-34	151	514	97	462	Beta-galactosidase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000482	0.998592	0.000388	0.000201	0.000171	0.000146

TMHMM  Annotations     

start	end
5	27