CAZyme Information: MGYG000000038_02154

Basic Information

• Species: Dorea_A longicatena
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Dorea_A; Dorea_A longicatena
• CAZyme ID: MGYG000000038_02154
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
765	MGYG000000038_10|CGC4	85316.67	8.8965

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000038	3124256	Isolate	United Kingdom	Europe

• Gene Location: Start: 86185; End: 88482 Strand: -

Full Sequence      

MKRIMTVMLAVIYITTGTISVMAGEPENNDAQKKESVSDSVKVQTSENTDEDRPKENSWR
YSNGELIPQEDDATSNARAVTNAWKKVNGQFVNSLGKPIPGAKKKGMDISEYQGTINWDT
VKNRSDIDFVIIRCSYGSGYKDRKWEYNVKECERLGIPYGVYIYSTATTVLAVEKEAENV
KKMLEGHQPTYPVYFDMEENSVLNLGSSTIGKLANTFCSKISGAGYKVGIYASLYWWNSI
LTDRVFKNESWSKWVAQYSASCQYQSKYDMWQCTSSGKVNGVSTNVDINFWMSDEPVINQ
DADRVIVSDENIITYTSHMQSYGWQEPVNNGYQTGKPGYGKRLEAFKINVGGGYGDLGVR
YQACIQDEGWKPLAETGQLAGTEGKSKYIQAVKISLTGSQAENYDIYYRVYSQNFGWLGW
TSNGQPAGSQGYEKRIEALQIAVLPKGATIPGTTDNSYKTTGKKVEYRTYVEKQGWKKYS
ADGEQSGTIGQARAVQGLAVRVNDTQYSGNIVYDTYMQSYGWMGEKANNTAAGILNGGKR
MEAIKLHLTGELAEKYDIYYRVHTQTFGWLDWAKNGEPSGTKDYAKRIEAVQVKVVPKGN
PAPGATSIAFKEAKIAYKTHVQTYGWMSKVHDGETAGTSGKAKRMEALNIAMVDSSYNKE
ISYRTHVQTYGWQKWVNGGKNSGTEGKAKRLEAIQIELKDSLADQYDIYYRVHAQTYGWL
GWAKNGEKAGTEGLAKRLEAIQIVLVEKGGAAPGSTNNFFIKKDK

Enzyme Prediction     

No EC number prediction in MGYG000000038_02154.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	107	282	4e-43	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	1.42e-84	104	292	1	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	7.60e-29	105	289	1	184	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
cd06523	GH25_PlyB-like	1.76e-25	108	289	4	175	PlyB is a bacteriophage endolysin that displays potent lytic activity toward Bacillus anthracis. PlyB has an N-terminal glycosyl hydrolase family 25 (GH25) catalytic domain and a C-terminal bacterial SH3-like domain, SH3b. Both domains are required for effective catalytic activity. Endolysins are produced by bacteriophages at the end of their life cycle and participate in lysing the bacterial cell in order to release the newly formed progeny. Endolysins (also referred to as endo-N-acetylmuramidases or peptidoglycan hydrolases) degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd06525	GH25_Lyc-like	1.25e-22	105	290	1	183	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd06524	GH25_YegX-like	3.38e-21	105	289	1	190	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWY97591.1	1.92e-120	49	657	40	635
QMW70654.1	6.03e-74	56	330	46	314
BCD36477.1	6.03e-74	56	330	46	314
QIA33416.1	1.84e-69	98	658	19	587
QCP36076.1	2.62e-67	40	290	28	285

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WW5_A	1.28e-22	104	291	269	467	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae at 1.6 A resolution [Streptococcus pneumoniae R6],2WWD_A 3D-structure of the modular autolysin LytC from Streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment [Streptococcus pneumoniae R6]
2WWC_A	3.05e-22	104	291	269	467	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae in complex with synthetic peptidoglycan ligand [Streptococcus pneumoniae R6]
4JZ5_A	9.90e-19	107	294	26	215	High-resolutionstructure of catalytic domain of endolysin ply40 from bacteriophage P40 of Listeria monocytogenes [Listeria phage P40]
1JFX_A	1.77e-10	105	289	6	200	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
4FF5_A	2.73e-09	86	289	41	247	Structurebasis of a novel virulence factor GHIP a glycosyl hydrolase 25 of Streptococcus pneumoniae participating in host cell invasion [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25310	1.90e-09	98	289	76	277	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000663	0.998483	0.000312	0.000187	0.000173	0.000157

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000038_02154.