CAZyme Information: MGYG000000039_00265

Basic Information

• Species: Faecalibacterium prausnitzii_H
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium prausnitzii_H
• CAZyme ID: MGYG000000039_00265
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
313	MGYG000000039_1|CGC3	36063.07	7.634

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000039	2848022	Isolate	United Kingdom	Europe

• Gene Location: Start: 284308; End: 285249 Strand: +

Full Sequence      

MLQDNLKNRVAAVVVTYNRLEFLKRCVNSLHKQTVPCDILVVDNASTDETAQWLESQTDI
FFHNTGSNLGGAGGFHYGMRWAVEANYDYLWVMDDDCFPKTDALEKLLSADSLLKGVYGW
MSSVALWTDGRECRMNRPKVKKSFYEHIELLREGVLQAEQATFVSLFLKSETVREVGLPI
AEYFIWGDDIEYTRRIAVRRNYPCYIVGQSQVIHAMKNNNGSNLALDDIERINRYWYAYR
NENYTYRQEGIKGICYYLARCGKHGTQILLSAKDHRLKRLVVLFQGMISGVGFAPKVEYV
ARTRNDAESTIRE

Enzyme Prediction     

No EC number prediction in MGYG000000039_00265.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	12	109	5.5e-22	0.5882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04185	GT_2_like_b	3.86e-74	12	245	1	202	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	7.59e-38	9	291	4	297	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	6.52e-23	13	214	2	164	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	2.06e-20	13	108	3	100	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd02526	GT2_RfbF_like	5.66e-20	12	241	1	232	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARR37379.1	6.43e-104	10	306	4	301
APG72354.1	1.29e-103	10	306	4	301
APG75322.1	1.49e-102	10	306	4	301
QDH97561.1	4.23e-102	10	306	4	301
AYC66889.1	4.23e-102	10	306	4	301

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0R5Z2	1.84e-12	10	252	7	261	Galactofuranosyltransferase GlfT1 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=glfT1 PE=1 SV=1
C5CBV8	8.37e-10	9	110	2	107	Undecaprenyl-phosphate mannosyltransferase OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) OX=465515 GN=Mlut_12000 PE=1 SV=1
P9WMX2	1.40e-09	10	252	5	258	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=glfT1 PE=3 SV=1
P9WMX3	1.40e-09	10	252	5	258	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glfT1 PE=1 SV=1
D4GU63	3.68e-08	2	218	12	224	Low-salt glycan biosynthesis hexosyltransferase Agl10 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=agl10 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000039_00265.