CAZyme Information: MGYG000000039_01819

Basic Information

• Species: Faecalibacterium prausnitzii_H
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium prausnitzii_H
• CAZyme ID: MGYG000000039_01819
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
533	MGYG000000039_10|CGC1	58120.76	6.1886

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000039	2848022	Isolate	United Kingdom	Europe

• Gene Location: Start: 46703; End: 48304 Strand: +

Full Sequence      

MYSSYSPLQQSQLAAQGYYDTQSTYLLVYAPGRNTALRATLADQLHRKFRLADTLGSALT
EGVDGVLLVSEDVECMSTALMCFAKALQDGADYAVCNAVFGFGGATALYQSRAHLAQNRC
AIVSRPLLERCRAAAKDPENVTELLALAAQFCAHPARIPQALLHYERDICAEDAFSATGK
RAFLMSHVLDMTGAPIVLVSAVPVLRSMGYEVVVLGPSDGGALQLFVDAGAAVITRPGIR
ATPNLWGLALCTDLVLVNTVVMARTVRALSGTAVPVLWWLHDAFAGYPHIAHQIPTKLAE
NVRLYSVGHHAANAMHAVRPDFQIGQLIYGLPDYAAEDFPRCDLGYPADKPLFATVGSFE
RRKGHDIFCAAIRLLPEEVRNKATFLFVGMAADKEMMDAVRSLTTDCPENVFYCKRLSRD
EIKNLMEQCTCLVCASRDDPMPTFVTEGLIFGKPSIVSEHTGTAGVITEGVDGFTYPDDD
PQKLAALLEWAIFHPEKLAAMKAACRKLYETHYSKQSFEQTLTAAVKELTADH

Enzyme Prediction     

No EC number prediction in MGYG000000039_01819.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	348	497	9.7e-22	0.91875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	6.12e-39	180	514	1	353	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
pfam16994	Glyco_trans_4_5	7.46e-39	179	313	2	167	Glycosyl-transferase family 4.
COG0438	RfaB	4.04e-26	196	533	21	381	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00534	Glycos_transf_1	2.02e-21	349	507	1	157	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd03811	GT4_GT28_WabH-like	4.84e-18	189	515	9	351	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA43728.1	9.40e-305	1	531	1	531
ATL90709.1	2.56e-302	1	531	1	531
AXA82476.1	2.21e-270	1	532	1	532
CBK99767.1	8.49e-268	1	532	1	532
CBL01560.1	9.01e-247	1	530	1	530

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000082	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000039_01819.