CAZyme Information: MGYG000000039_02371

Basic Information

• Species: Faecalibacterium prausnitzii_H
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium prausnitzii_H
• CAZyme ID: MGYG000000039_02371
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
983	MGYG000000039_18|CGC1	106860.59	4.0542

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000039	2848022	Isolate	United Kingdom	Europe

• Gene Location: Start: 12542; End: 15493 Strand: +

Full Sequence      

MLSINLDDVMQVLTNVRSYLIAFGVVLALAIIVMVAVRKLPKAKKKMIRAQSGLAILLAL
TIVVNLICTGPMSTMLDLVSGSGTISEETSAKATQLVNEITAEGVVLAKDEDNVLPVASG
SKLNVFGWSSTNPCYGGTGSGALNTAYPVTDLLTGLHDAGIETNEELSKFYTDYKADRPS
VGMVEQDWTLPEPNVSLYTDEMMENAKAFSDTAMVVITRVGGEGADLPTDMASVVDGSWI
RRVAQAYGSERGTAYYNGTYDDSLNEGNDWDKGDHFLQLSNREEDLLDLVTSNFDNVILV
YNGANAFQMDFLKDYPQIKGVLLCPGTGQSGFEGFGKVVSGEVNPSGRTADTYVSDLTAA
PWWNNFGDFKYTNTEDLNSDASFFDPEGTTPSFVNYVEGIYVGYKFYETAADEGLINYDD
EVVFPFGYGLSYTSFTKEMSGITSDGTNLNFTVTVTNTGSAAGKDVVEIYSNPPYTNGGI
EKASANLLDFAKTNELAPGESQTMEFSIPVEDLASYDYQTNGCYVLEAGDYIISANNDSH
NVADSKTYTVASDIVYNESNKRSSDAVAATNEFDFAEGDITYLSRADGFANYAEATAAPA
NYEMSDADKAVFYNAHSYTESGYEADDDANAEDITTGAKNGLKLVDLRGVDYNDPKWDDL
LDQMTVEDMQQLIGFGGYQTAAVTSIEKVRTNDCDGPASINNNFTGVGSVGFPAATLIGM
TWSKELAYSFGDSIGEMANEMDTSGWYGPAMNIHRTAFAGRNFEYYSEDGVLSGVMASNA
IKGAQEHGVYAYMKHFALNDQEGNRTSMVATWSNEQAIREIYLRPFEISVKDADCHAVMS
SFNYIGNCWAGGCSELLKNVLRGEWGFVGFVETDYFGVYGYMTADQGVRNGSDLMLCTTG
NDFNTVTVLTNSSKQALREASKNILYTVVNSRAYAEENLNPGMPKWKIIMIGADVIVALL
IVGLEYTAIKGYKKRKEEEAENA

Enzyme Prediction     

No EC number prediction in MGYG000000039_02371.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	702	896	1.4e-48	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.55e-27	680	925	47	309	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	3.36e-19	712	899	88	287	Glycosyl hydrolase family 3 N terminal domain.
PRK15098	PRK15098	8.29e-16	418	542	631	757	beta-glucosidase BglX.
pfam14310	Fn3-like	5.57e-13	465	539	1	71	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.
pfam01915	Glyco_hydro_3_C	1.73e-11	105	404	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXA81991.1	0.0	1	981	1	981
CBK98878.1	0.0	1	981	1	981
AXB27516.1	0.0	1	979	1	947
AOZ95740.1	0.0	1	980	1	974
ADL34829.1	0.0	10	980	1	965

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WUG_A	3.80e-79	102	937	45	828	Expression,characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii],5WVP_A Expression, characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
2X40_A	2.20e-40	656	934	3	310	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	2.19e-39	656	934	3	310	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
7MS2_A	2.85e-28	660	899	8	253	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
3AC0_A	1.87e-27	695	894	45	242	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16084	3.69e-88	90	891	25	789	Beta-glucosidase A OS=Butyrivibrio fibrisolvens OX=831 GN=bglA PE=3 SV=1
P15885	7.95e-77	99	937	15	771	Beta-glucosidase OS=Ruminococcus albus OX=1264 PE=3 SV=1
P27034	2.46e-35	658	894	3	239	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
A1DFA8	2.49e-34	661	894	10	242	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
A2R989	5.38e-34	678	894	7	221	Probable beta-glucosidase I OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000018	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
15	37
54	76
948	966