CAZyme Information: MGYG000000041_00611

Basic Information

• Species: Acetatifactor sp900066365
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor; Acetatifactor sp900066365
• CAZyme ID: MGYG000000041_00611
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
790		89381.67	6.504

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000041	3646137	Isolate	United Kingdom	Europe

• Gene Location: Start: 68953; End: 71325 Strand: -

Full Sequence      

MKKISLNNNWICKRAGQPEQGMTVNIPHDAMQMDEKDELSAGGVHNGWYVCHDYIYEKAF
CASEDWREKRVILEFEGIYKNAIVFLNGERIAVHEYGYTGFYIDISERLCYEKDNSIKVY
VSNSEQPNSRWYSGTGIYRPVWLYLLPVEHIEMDGIRITTLPGEIPAIGIDIATTGDGEL
DIEILEKGQLLTKVSSRAEQKKCHLEISLPQAKRWMPEQPQLYLCRVTFGEDQREERFGI
REIRCDAQNGFCINGKRIILRGACIHHDNGLLGACAYDYAEYRKIRILKENGYNAIRSAH
NPCSKAMLRACDELGMLVLDEYVDVWYIHKTKYDYADRVIQNYETDLKAMTDKDYNHPSV
VMYSIGNEVSETAQKKGIELCGKMTQKLHELDGTRPVTCGINIFFNFLSSIGFGVYSDKK
AEQETKNSKRKKVGSEFFNSLAGILGAGFMKFGATLYPCDLKTRDAFGKLDIAGYNYGIN
RYRHDLKKYPSRLILGSETFCSDAAKFYQLAQKNPRIIGDFVWAGMDYLGEVGVGAWEYA
DYAPRFDGGKGWVSAGSGRIDLTGKPLAEMAYTQVAFGLRELAVGVIPVNHTKDKHSPSA
WKMSNALESWSYEGYDGETACVEVSTGAAYVEFILNDEIIRKRKVKNRECFQTKIPYRSG
TLQIKAYAADGSLIAEQRLQTAGRETQLRMFPEQTTIDTSELCYIRICYTDENGILKPLI
RDELRVEVSGGILLGFGNACPYHERSYKGDVTDTYYGEALAIIQPQEMGEITVRATGSYG
TAETKIKVRV

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	2	679	4.3e-99	0.6715425531914894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.63e-61	1	417	10	447	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	3.39e-41	53	405	62	452	beta-D-glucuronidase; Provisional
PRK10340	ebgA	8.21e-25	55	397	112	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam18565	Glyco_hydro2_C5	1.04e-17	688	777	1	94	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
pfam02836	Glyco_hydro_2_C	1.29e-15	251	418	8	183	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFJ54527.1	0.0	1	788	1	791
QRT30385.1	0.0	1	789	1	797
QHB24152.1	0.0	1	789	1	797
QEI31653.1	0.0	1	789	1	797
QTL77819.1	0.0	1	789	9	805

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B6L_A	1.16e-110	13	775	26	763	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	4.78e-110	13	775	26	763	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5T98_A	1.34e-83	4	790	28	822	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
4YPJ_A	2.79e-82	2	776	8	794	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
7CWD_A	2.97e-81	1	776	1	788	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	5.55e-73	24	788	74	846	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	1.30e-49	5	777	50	811	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KPJ7	1.11e-32	3	432	53	507	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P77989	5.45e-29	56	789	60	737	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
Q56307	6.12e-24	3	371	73	444	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000041_00611.