CAZyme Information: MGYG000000041_01818

Basic Information

• Species: Acetatifactor sp900066365
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor; Acetatifactor sp900066365
• CAZyme ID: MGYG000000041_01818
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
685	MGYG000000041_12|CGC2	78401.41	6.2788

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000041	3646137	Isolate	United Kingdom	Europe

• Gene Location: Start: 96163; End: 98220 Strand: +

Full Sequence      

MSEINYQEAYEREHEKCADLADKIVVLESEKEDLQFKLDRIKKNKFWKATGPARSLIHFA
QRQRDRLSHCGGPKDILRKIRNKSRQKSLMESYGTGSFPDAEQRKKEEETIFPYMPKISI
LVPLWNNKREFQIQMLDCVMNQTYPNWELCLADGSDAEHSYIEELCREYAAKANGRIVYK
HLDHNGGISYNTNECYKLATGDYIGLFDQDDILHPSVLYAYVKEINEQGADYLYCDETTF
KENDINKMLTMHFKPDYAPDNLRANNYICHFSVFSRKLLEGEELFRTAFDGAQDHDMILR
LTDRAEKIVHVPRLMYYWRSHEGSTAASIDAKPYAIEAAKGAVADHLKKHGFKHFQITST
RACATIFRIRYQILGDPKISIVIANKDHVEDLKRCITSIQKNSTWSNYEIIVVENNSTTP
EIKDYYSQLLGLSGDDSYEERCKLHTVCGHDGGILHSGDGRISIVTYQGDFNYSAVNDLG
ASYASGEYILLLNNDTEVITANWMEEMLMYAQREDVGAVGAKLYYADKTIQHAGVVIGLG
AHRTAGHTHYRIPVQNLGYMGRLCYTQNVTAVTGACLLVKKSLYEQVGGLDESFVISLND
VDFCLKLRKLGLLNVWTPFAELYHYESISRGLDDQGEKAERYNRESGHFREKWKAELEAG
DPYYNPNFSLDRSDYALKDPAVSGR

Enzyme Prediction     

No EC number prediction in MGYG000000041_01818.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	119	279	2.1e-19	0.9705882352941176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	8.20e-74	116	319	1	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.01e-34	381	626	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	3.93e-29	377	631	3	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	6.15e-18	119	279	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06433	GT_2_WfgS_like	8.19e-18	119	325	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM02106.1	0.0	1	685	1	685
ADL33299.1	1.03e-309	1	677	1	671
AOZ95572.1	1.31e-303	1	677	1	673
QUO22278.1	2.13e-274	37	678	17	629
CAB1243278.1	2.63e-221	5	679	384	1034

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	1.64e-11	118	318	7	215	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.27e-125	116	680	366	900	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.21e-79	116	678	319	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P77414	1.17e-12	116	311	5	207	Putative colanic acid biosynthesis glycosyl transferase WcaA OS=Escherichia coli (strain K12) OX=83333 GN=wcaA PE=4 SV=1
A0A0H2UR96	2.92e-11	118	324	5	220	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
P9WMY2	7.86e-09	572	633	183	244	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000041_01818.