CAZyme Information: MGYG000000041_01895

Basic Information

• Species: Acetatifactor sp900066365
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor; Acetatifactor sp900066365
• CAZyme ID: MGYG000000041_01895
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329	MGYG000000041_13|CGC2	37787.14	4.4512

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000041	3646137	Isolate	United Kingdom	Europe

• Gene Location: Start: 80823; End: 81812 Strand: -

Full Sequence      

MTTADAKATQEARELLEYLKNTAGQQIITGQHTQTIPCEEIAYIRQTTGKEPKLRGFELL
AYSPNINYADASPECLTEVEENKGTAETALQWARANRPDKVNDTGTENSTDYTTGGILTF
SFHWFSPLGGRDKSFYTEHTDFDAAKILQEGTPERAAFYHDMDAIAGILQQFQQEHIPIL
WRPFHESYGTWFWWGAKGAKVARDLYRLMFEYYTGEKNLHNLLWVWNCDIEEAYPGDEYV
DVVSIDVYLPEYQSTDYADAYEKLVAATSRDKVAALAEVGYLPDVELLQKSRIPWAYYMT
WSKEFCIGEKYNSVENLKKMYDSEYAVTL

Enzyme Prediction     

No EC number prediction in MGYG000000041_01895.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	5	329	1.2e-90	0.9867986798679867

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.70e-47	5	328	2	308	Glycosyl hydrolase family 26.
COG4124	ManB2	5.40e-13	162	281	164	297	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM01251.1	4.70e-242	1	329	6	334
CBK82137.1	1.06e-157	4	328	5	311
AEB13973.1	1.34e-150	3	329	4	310
AZK45707.1	4.38e-123	1	329	4	314
QUL56288.1	3.47e-118	8	329	14	317

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPF_A	1.14e-57	2	328	5	306	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3ZM8_A	8.14e-57	8	329	150	444	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
3WDQ_A	1.71e-45	115	329	127	349	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HF2_A	1.08e-40	8	301	50	314	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6Q75_A	6.61e-34	5	328	25	323	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	4.15e-54	8	329	179	473	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	9.31e-54	7	329	32	347	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P49425	3.68e-49	4	328	147	453	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
A2R6F5	2.55e-47	5	329	30	330	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55296	1.39e-38	2	329	156	457	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000041_01895.