CAZyme Information: MGYG000000041_02676

Basic Information

• Species: Acetatifactor sp900066365
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor; Acetatifactor sp900066365
• CAZyme ID: MGYG000000041_02676
• CAZy Family: CE19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361		41325.93	4.7637

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000041	3646137	Isolate	United Kingdom	Europe

• Gene Location: Start: 47111; End: 48196 Strand: +

Full Sequence      

MEQADTIIQIPHFYGSLKGMQDKFDKYARQDAFAGSTREEWEAWKETSRETLKDLLGWKY
MESCDLDPRVEEVVELENGIRREKVIIQVEPEVYMPMYILIPPKQDEEKQKCFLALPGHQ
GAGKFSVAGRDDIPAVKRMIEFYHYDYGMQLAKRGYVAICPDCRGFGERRDEALQKGTDE
KSFLTSTCFHLAHMAEPLGETVAGMCTWDASRLIDYVYERGEWDTDDLGVVGFSGGGMQT
LWISALDDRVKKCIISGYLYGYRDALLLLNGNCSCNYVPHLWEHFDMGDIASLIAPRPLA
VQSCRDDHLNGPRGLVNVTEQLDIVRKAYSLYGKEEYPIHDVREGDHCWHEEVLDIALPR
L

Enzyme Prediction     

No EC number prediction in MGYG000000041_02676.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE19	37	336	3.1e-33	0.7680722891566265

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0412	DLH	2.46e-05	146	267	45	152	Dienelactone hydrolase [Secondary metabolites biosynthesis, transport and catabolism].
COG1506	DAP2	0.010	145	267	412	521	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUC03567.1	1.45e-117	8	347	350	691
ATP54718.1	4.18e-112	8	347	356	697
QIA34433.1	2.95e-107	20	347	368	697
VTS07446.1	4.45e-20	66	361	81	353
VIP05045.1	4.45e-20	66	361	81	353

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NUZ_A	1.73e-08	40	333	52	335	Crystalstructure of a putative acetyl xylan esterase (BF1801) from Bacteroides fragilis NCTC 9343 at 2.30 A resolution [Bacteroides fragilis NCTC 9343],3NUZ_B Crystal structure of a putative acetyl xylan esterase (BF1801) from Bacteroides fragilis NCTC 9343 at 2.30 A resolution [Bacteroides fragilis NCTC 9343],3NUZ_C Crystal structure of a putative acetyl xylan esterase (BF1801) from Bacteroides fragilis NCTC 9343 at 2.30 A resolution [Bacteroides fragilis NCTC 9343],3NUZ_D Crystal structure of a putative acetyl xylan esterase (BF1801) from Bacteroides fragilis NCTC 9343 at 2.30 A resolution [Bacteroides fragilis NCTC 9343],3NUZ_E Crystal structure of a putative acetyl xylan esterase (BF1801) from Bacteroides fragilis NCTC 9343 at 2.30 A resolution [Bacteroides fragilis NCTC 9343],3NUZ_F Crystal structure of a putative acetyl xylan esterase (BF1801) from Bacteroides fragilis NCTC 9343 at 2.30 A resolution [Bacteroides fragilis NCTC 9343]
7B7H_A	5.44e-06	150	344	177	382	ChainA, Putative acetyl xylan esterase [Opitutus terrae PB90-1]
6GRW_A	9.31e-06	150	344	159	364	GlucuronoylEsterase from Opitutus terrae (Au derivative) [Opitutus terrae PB90-1],6GS0_A Native Glucuronoyl Esterase from Opitutus terrae [Opitutus terrae PB90-1]
6SYU_A	9.59e-06	150	344	177	382	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with xylobiose [Opitutus terrae],6T0I_A The wild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with the aldotetrauronic acid XUX [Opitutus terrae]
6SZ0_A	9.59e-06	150	344	177	382	Theglucuronoyl esterase OtCE15A H408A variant from Opitutus terrae [Opitutus terrae PB90-1],6SZ4_A The glucuronoyl esterase OtCE15A H408A variant from Opitutus terrae in complex with, and covalently linked to, D-glucuronate [Opitutus terrae PB90-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34973	5.56e-16	61	325	24	262	Putative hydrolase YtaP OS=Bacillus subtilis (strain 168) OX=224308 GN=ytaP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000041_02676.