CAZyme Information: MGYG000000042_00935

Basic Information

• Species: Phocaeicola sp900066445
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900066445
• CAZyme ID: MGYG000000042_00935
• CAZy Family: PL35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
593	MGYG000000042_2|CGC8	68393.1	7.241

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000042	3613218	Isolate	United Kingdom	Europe

• Gene Location: Start: 337139; End: 338920 Strand: +

Full Sequence      

MFRFIFLFIFVCFVNNLFPIESHPRLLLKRDEENRIKMMIIEHEQMKTVHDYIIKYSDKT
IGESPVNRIKQGKRLLAVSRIALQRIYFLSYSYRMTKNIKYAERAKQELLAVCNFQDWNP
SHYLDVGEMAMAVAIGYDWLYDYLSENVKMKLRKAIVEKAFNTAEIGGFYDRTNNWNQVC
NAGLVLAALAIYEEEKEKSDYIIDKAVKTVPLAMESYSPDGIYPEGFSYWGYGTGFQVTM
LAAMESALGTDFGLSDNYGFLKSPYFMLYMTAPSGWCYNFCDSGRKIDLNQAMYWFASKN
KDTSLLWYECYYLKRLNKYTGNDIDRLLPNILIFSKDIDLANLKEPKGKFFSGKGIKPVF
IYRSGWSNKTDSYLGVVAGSPSIPHGHMDSGSFVYEKKGERWAIDLGLQSYYTLEKEGVD
LWNSSQNGQRWDVFRLGNTGHTTITINGKKHLVTGNPEFIETYQKSDYKGAKIDMTSLYG
DDVNNVLRSVYLDRNDDLNIIDEIQTNDNNAEIMWTMVTSAQAKIIKDNIIELSKNGKKM
RFHVEAPIDINLKIWDNKPVHHYDQDNPGTVRVGFTADLSSNDIFKFKVTVKE

Enzyme Prediction     

No EC number prediction in MGYG000000042_00935.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL35	370	547	1.7e-60	0.9776536312849162

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16332	DUF4962	1.57e-07	22	275	136	406	Domain of unknown function (DUF4962). This family consists of uncharacterized proteins around 870 residues in length and is mainly found in various Bacteroides species. The function of this protein is unknown.
pfam05147	LANC_like	2.14e-05	86	251	15	181	Lanthionine synthetase C-like protein. Lanthionines are thioether bridges that are putatively generated by dehydration of Ser and Thr residues followed by addition of cysteine residues within the peptide. This family contains the lanthionine synthetase C-like proteins 1 and 2 which are related to the bacterial lanthionine synthetase components C (LanC). LANCL1 (P40 seven-transmembrane-domain protein) and LANCL2 (testes-specific adriamycin sensitivity protein) are thought to be peptide-modifying enzyme components in eukaryotic cells. Both proteins are produced in large quantities in the brain and testes and may have role in the immune surveillance of these organs. Lanthionines are found in lantibiotics, which are peptide-derived, post-translationally modified antimicrobials produced by several bacterial strains. This region contains seven internal repeats.
cd04434	LanC_like	0.004	86	249	8	175	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBN17882.1	3.35e-227	15	582	32	606
QNL40059.1	6.09e-219	20	589	28	598
QRQ54739.1	2.82e-217	20	589	28	598
QIU93528.1	2.82e-217	20	589	28	598
ALJ47853.1	2.82e-217	20	589	28	598

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3A0O_A	3.27e-09	129	563	259	717	Crystalstructure of alginate lyase from Agrobacterium tumefaciens C58 [Agrobacterium fabrum str. C58],3A0O_B Crystal structure of alginate lyase from Agrobacterium tumefaciens C58 [Agrobacterium fabrum str. C58]
3AFL_A	3.90e-08	129	289	259	423	Crystalstructure of exotype alginate lyase Atu3025 H531A complexed with alginate trisaccharide [Agrobacterium fabrum str. C58]
2FUQ_A	1.81e-06	19	471	19	446	ChainA, heparinase II protein [Pedobacter heparinus],2FUQ_B Chain B, heparinase II protein [Pedobacter heparinus]
3E80_A	1.82e-06	19	471	21	448	Structureof Heparinase II complexed with heparan sulfate degradation disaccharide product [Pedobacter heparinus],3E80_B Structure of Heparinase II complexed with heparan sulfate degradation disaccharide product [Pedobacter heparinus],3E80_C Structure of Heparinase II complexed with heparan sulfate degradation disaccharide product [Pedobacter heparinus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000404	0.998969	0.000181	0.000139	0.000143	0.000148

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000042_00935.