CAZyme Information: MGYG000000042_00936

Basic Information

• Species: Phocaeicola sp900066445
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900066445
• CAZyme ID: MGYG000000042_00936
• CAZy Family: PL35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
603	MGYG000000042_2|CGC8	68308.16	6.925

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000042	3613218	Isolate	United Kingdom	Europe

• Gene Location: Start: 338941; End: 340752 Strand: +

Full Sequence      

MNMLLQRLLLTIITIVSSVNVFSQDNIASHPRLLLKADEEKKIEKMINEDVNMALVHNAI
IDYCNKAINEPPVEHVLQGKRLLAKSNLAFQRVFYLSYAYRLTNNERYLKRAEKELITVC
KFKDWNPQHFLDVADMLMAVSIGYDWLYDALSKETLDLIEKAIIEKGFTPAKDDRYNGFY
KRTNNWNQVCNAGLVMGALAIYEKNPKLSQKIIKSSVESVPLAMEAYGPDGAYQEGSAYW
GYGTGYEAIMISALESALGTDYGLTKDKNFMKSAYFLLYTLAPSGKCYNYSDAGSSVGIN
QALFWFAKKIGDSSLLWFELPKLNEKKNHLSKDRLLPNILINAKDIAIDEIKKPSGNFWF
SRGIKPLYVYRSGWDNPDDTYLGIVGGSAKAPHGHMDAGSFVFEKNGVRWSMELGLQSYY
SLEKEGVDLWNSSQNGQRWDVFRYGNTGHSTLTINGKHHLVDGNPPIVETYMKDNLKGAK
VDLSSIFSQSVKSSIRKITLDKDDVLNIEDVIETNDSVADVMWVMVTPAEATILNKNQIL
LKKDGKEMIMTVHSELPVEMNIWDNKPVHYYDQDNPGTLRVGFKCKLPSNSKNIFNVELK
DKE

Enzyme Prediction     

No EC number prediction in MGYG000000042_00936.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL35	378	555	3.3e-61	0.9776536312849162

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16332	DUF4962	3.63e-09	18	335	125	461	Domain of unknown function (DUF4962). This family consists of uncharacterized proteins around 870 residues in length and is mainly found in various Bacteroides species. The function of this protein is unknown.
pfam05147	LANC_like	7.55e-06	93	287	15	205	Lanthionine synthetase C-like protein. Lanthionines are thioether bridges that are putatively generated by dehydration of Ser and Thr residues followed by addition of cysteine residues within the peptide. This family contains the lanthionine synthetase C-like proteins 1 and 2 which are related to the bacterial lanthionine synthetase components C (LanC). LANCL1 (P40 seven-transmembrane-domain protein) and LANCL2 (testes-specific adriamycin sensitivity protein) are thought to be peptide-modifying enzyme components in eukaryotic cells. Both proteins are produced in large quantities in the brain and testes and may have role in the immune surveillance of these organs. Lanthionines are found in lantibiotics, which are peptide-derived, post-translationally modified antimicrobials produced by several bacterial strains. This region contains seven internal repeats.
pfam07940	Hepar_II_III	1.47e-04	378	457	20	88	Heparinase II/III-like protein. This family features sequences that are similar to a region of the Flavobacterium heparinum proteins heparinase II and heparinase III. The former is known to degrade heparin and heparin sulphate, whereas the latter predominantly degrades heparin sulphate. Both are secreted into the periplasmic space upon induction with heparin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL40059.1	1.76e-223	8	599	5	600
QIU93528.1	1.76e-223	22	590	23	591
QRQ54739.1	2.49e-223	22	599	23	600
CBK67360.1	2.49e-223	22	599	23	600
QUT26392.1	2.49e-223	22	599	23	600

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3A0O_A	1.59e-07	29	318	138	447	Crystalstructure of alginate lyase from Agrobacterium tumefaciens C58 [Agrobacterium fabrum str. C58],3A0O_B Crystal structure of alginate lyase from Agrobacterium tumefaciens C58 [Agrobacterium fabrum str. C58]
3AFL_A	1.59e-07	29	318	138	447	Crystalstructure of exotype alginate lyase Atu3025 H531A complexed with alginate trisaccharide [Agrobacterium fabrum str. C58]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000223	0.999161	0.000152	0.000148	0.000140	0.000129

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000042_00936.