CAZyme Information: MGYG000000042_00939

Basic Information

• Species: Phocaeicola sp900066445
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900066445
• CAZyme ID: MGYG000000042_00939
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
610	MGYG000000042_2|CGC8	69799.62	6.7223

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000042	3613218	Isolate	United Kingdom	Europe

• Gene Location: Start: 343346; End: 345178 Strand: +

Full Sequence      

MKKEVVFGTIFLMVAFCGRLSSKNSHINSFSCDNNLQVSAAISKTSDFTFNLYKNPFSCF
GSHMSLLCSYDDVLGTDSLILTDLTKGREADKLLFQINPVNVNNKHEKVHYTATPIELRG
KTKDGNISIFFESPQVLHICSDNLDLQFSGRYEGNAYSFPFQEDVFHLNGQYNNTFIVRD
KGIAITVKSGILSYNNNCFLLKKDSKRKIEVVVEQYFGDWIPKHYTTSKEIILDRLKKEY
SEWENKIASVSPEYEEGRKLASYMSWSCMYEPRGNITRYGMSMSKGFMLYIWSWDHCFNA
LGLSYSHPKLSWDQFMIMFDHQDNRTGALPDYIGANNKLWTVKKPPIHGWTLSLLLQQYV
PEKDKLEEVYNKLSNWTNYWLNCRDDDGNGLPQYYHGMDSGWDNGTCFDVGMPAEGPDLA
AFLVLQMEVLSNLAEKLSDSLAAKKWNECSKTMLDRLIKEFWNGEKFITRRTGTHEVNPN
SQSLMSYLPIVLGKRLPKDIREKMISDLKKEGFLLTPYGLASESPKSLLYESDGYWRGPI
WAPTTLIVIDGLKQCGEVGLAKEIAKRFCDTCMKSGFAENFDALTGEALRDVSYTWTSSV
FLVLAHEYLK

Enzyme Prediction     

No EC number prediction in MGYG000000042_00939.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	254	609	2.4e-48	0.44035087719298244

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3408	GDB1	1.05e-22	291	602	284	600	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam03200	Glyco_hydro_63	3.49e-09	485	605	351	493	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
PRK10137	PRK10137	1.20e-07	292	394	348	467	alpha-glucosidase; Provisional
pfam01204	Trehalase	2.88e-05	418	575	306	462	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
PRK13270	treF	1.70e-04	418	571	350	496	alpha,alpha-trehalase TreF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZU60435.1	2.09e-147	50	606	2	557
QIZ06325.1	3.90e-146	50	604	2	555
AEE95252.1	2.95e-142	50	609	3	564
AIK35968.1	1.07e-141	50	609	2	559
AJI18050.1	1.07e-141	50	609	2	559

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WVA_A	1.00e-11	284	602	24	416	Crystalstructure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVA_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVB_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVB_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVC_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8],4WVC_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8]
6G3N_A	1.75e-09	290	602	40	444	Mycobacterialhydrolase complex 14. [Mycolicibacterium hassiacum DSM 44199],6G3N_B Mycobacterial hydrolase complex 14. [Mycolicibacterium hassiacum DSM 44199]
5OHC_A	5.38e-09	290	602	40	444	Crystalstructure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) in complex with glycerol [Mycolicibacterium hassiacum DSM 44199],5OHC_B Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) in complex with glycerol [Mycolicibacterium hassiacum DSM 44199],5OI0_A Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) in complex with serine and glycerol [Mycolicibacterium hassiacum DSM 44199],5OI0_B Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) in complex with serine and glycerol [Mycolicibacterium hassiacum DSM 44199],6Q5T_A Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) - apo form [Mycolicibacterium hassiacum DSM 44199],6Q5T_B Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) - apo form [Mycolicibacterium hassiacum DSM 44199]
5OIE_A	2.89e-08	290	602	40	444	Crystalstructure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) E419A variant in complex with serine and glycerol [Mycolicibacterium hassiacum DSM 44199],5OIE_B Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) E419A variant in complex with serine and glycerol [Mycolicibacterium hassiacum DSM 44199],5OJU_A Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) E419A variant in complex with glucosylglycerate [Mycolicibacterium hassiacum DSM 44199],5OJU_B Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) E419A variant in complex with glucosylglycerate [Mycolicibacterium hassiacum DSM 44199],5OJV_A Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) E419A variant in complex with mannosylglycerate [Mycolicibacterium hassiacum DSM 44199],5OJV_B Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) E419A variant in complex with mannosylglycerate [Mycolicibacterium hassiacum DSM 44199],5ONT_A Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase(MhGgH) E419A variant in complex with glucosylglycerol [Mycolicibacterium hassiacum DSM 44199],5ONT_B Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase(MhGgH) E419A variant in complex with glucosylglycerol [Mycolicibacterium hassiacum DSM 44199],5OO2_A Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) E419A variant in complex with glucosylglycolate [Mycolicibacterium hassiacum DSM 44199],5OO2_B Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) E419A variant in complex with glucosylglycolate [Mycolicibacterium hassiacum DSM 44199]
5OIV_A	5.05e-08	290	602	40	444	Crystalstructure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) D43A variant in complex with serine and glycerol [Mycolicibacterium hassiacum DSM 44199],5OIV_B Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) D43A variant in complex with serine and glycerol [Mycolicibacterium hassiacum DSM 44199]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D8QTR2	1.49e-09	284	602	90	482	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	1.96e-09	284	602	90	482	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
K5BDL0	2.93e-08	290	602	38	442	Glucosylglycerate hydrolase OS=Mycolicibacterium hassiacum (strain DSM 44199 / CIP 105218 / JCM 12690 / 3849) OX=1122247 GN=ggh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.013711	0.646993	0.338438	0.000306	0.000260	0.000256

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000042_00939.