CAZyme Information: MGYG000000042_01435

Basic Information

• Species: Phocaeicola sp900066445
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900066445
• CAZyme ID: MGYG000000042_01435
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326		37842.13	7.1957

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000042	3613218	Isolate	United Kingdom	Europe

• Gene Location: Start: 71733; End: 72713 Strand: +

Full Sequence      

MINKLKKELSGIYKVLILVCVLPFLVSAYCIGSDNREEQTDDDRYTCVDVPRYTVFCGDT
IDLTRYDRHERMDRELLAFSFMHSTSIQTIKRANRYFPVIVPILKEKGIPEDFKYLMAIE
SACNPLARSGAGAAGLWQFMPTTGKEYGLEVNSHVDERYNVEKATYAACKYLKDAYNKFG
DWVSVAASYNAGQERISQQQEKQYTDETLDLYLVEETARYIYRIFAVKMLFENPTDFGFY
LRSSDLYPQIHYRTVKVSETITDLARFAKSQGTTYALLKNLNPWLRSTSLPCKNGKEYEI
KLPDKNNMNYNPDFTMPYSRNWVIDK

Enzyme Prediction     

No EC number prediction in MGYG000000042_01435.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	103	226	1.2e-24	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	1.67e-62	104	229	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK10783	mltD	7.90e-26	80	306	92	314	membrane-bound lytic murein transglycosylase D; Provisional
pfam01464	SLT	3.19e-25	107	205	8	108	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	2.89e-19	116	226	7	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	2.21e-15	96	226	6	144	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO24006.1	5.97e-142	17	325	15	322
ADY36030.1	1.73e-139	21	324	15	323
QUT56374.1	8.97e-132	18	325	16	332
QEW35083.1	1.27e-131	18	325	16	332
QQY40386.1	1.27e-131	18	325	16	332

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	4.34e-21	55	305	61	310	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	4.34e-21	55	305	61	310	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
O31608	8.39e-07	112	192	74	152	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.225203	0.376423	0.396035	0.000639	0.000585	0.001095

TMHMM  Annotations     

start	end
9	31