CAZyme Information: MGYG000000042_01485

Basic Information

• Species: Phocaeicola sp900066445
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900066445
• CAZyme ID: MGYG000000042_01485
• CAZy Family: GH97
• CAZyme Description: Glucan 1,4-alpha-glucosidase SusB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
668		76367.09	6.2997

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000042	3613218	Isolate	United Kingdom	Europe

• Gene Location: Start: 128437; End: 130443 Strand: +

Full Sequence      

MNKITLLAVLSFFIYACSGGKTEVSSPDKTINVIFTVNNENKPTYQIKVKDSVLILPSVM
GFRDLYGASLSSHLKINGVEHTSADETWTQPWGENKTIRNKYNEMAVRLSDCKQVDLTIR
FRAFDDGVGFRYEYDVRDVDSLFIIDELTEFNIAKDGKSWSIPANFETYELLYRNKSLSE
IKNANTPITFKSGSVYTSIHEAALTDFPEMTLKRIEGTTFKSELAPWPDGIKVKIAGGKF
VTPWRTVQIGSKAVDLINSSLILNLNEPCKLESTDWIRPMKYIGIWWGMHLGVETWYEGK
RHGATTANAKRYIDFAAENNIDAVMYEGWNKGWENWGGTQHFDYTAPYDDFNIEELVDYA
NKKGVRIIGHHETGGNILNYERQLDNAYKWYYDMGINAVKTGYAGGLPNGHNHHGQFNVR
HYRKVVETAAKYHTTLDVHEPIKDTGIRRTYPNMMTREGARGMEWNAWSDGNPPSHHVIL
PFTRLLAGPMDYTPGIFDITYERIKNSPDRKKWNMKDSKDCRVNTTLAKQIANWVILYSP
LQMASDMIENYEGHPAFQFFRDFDPDCEWSKALDGEPGEYVVIVRKAKDKFFLGASTNEQ
ARDIDIKLDFLEDGYYYDAVIYADGDDADWETNPSSYKITHCKVSNKDSLHIKMARGGGQ
AVYFKLLD

Enzyme Prediction     

No EC number prediction in MGYG000000042_01485.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	12	664	2e-230	0.9904912836767037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	7.71e-142	274	563	2	277	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	1.67e-79	26	268	1	235	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	9.73e-40	567	665	1	97	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT77960.1	0.0	22	668	24	670
QDO69364.1	0.0	16	664	17	665
ALJ61481.1	0.0	1	664	1	666
QUT92945.1	0.0	2	664	4	667
QQY39388.1	0.0	9	667	8	669

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HQ4_A	9.66e-196	24	667	3	661	AGlycoside Hydrolase Family 97 enzyme from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8],5HQA_A A Glycoside Hydrolase Family 97 enzyme in complex with Acarbose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQC_A	9.66e-196	24	667	3	661	AGlycoside Hydrolase Family 97 enzyme R171K variant from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQB_A	2.74e-195	24	667	3	661	AGlycoside Hydrolase Family 97 enzyme (E480Q) in complex with Panose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
3WFA_A	1.42e-161	23	665	4	704	Catalyticrole of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron],3WFA_B Catalytic role of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron]
2JKA_A	1.47e-161	23	665	13	713	Nativestructure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKA_B Native structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKE_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKE_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKP_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482],2JKP_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G8JZS4	2.51e-162	1	665	1	724	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1
Q8A6L0	1.05e-63	1	665	1	662	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
D7CFN7	1.28e-34	44	627	60	591	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000086	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000042_01485.