CAZyme Information: MGYG000000042_02280

Basic Information

• Species: Phocaeicola sp900066445
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900066445
• CAZyme ID: MGYG000000042_02280
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377	MGYG000000042_13|CGC1	42729.65	9.2998

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000042	3613218	Isolate	United Kingdom	Europe

• Gene Location: Start: 29741; End: 30874 Strand: +

Full Sequence      

MKYYLIVGEASGDLHASNLMCSLKKYDENAEFRFFGGDLMQSVGGTLVKHYKDMAYMGFI
PVLLHLRTIFRNMSLCKSDILEWKPDVIILVDYPGFNLKIAKYIKQHTDIPVYYYISPKI
WAWKEYRIKDIKRDIDKMLSILPFEIDFYKKHNYPISYVGNPSVDSVSEYLANHPSDRLS
FIKDNGLSDKPIVAILAGSRKQEIRDNLTRMMEVARSFPQYQFVVAGAPGISHDYYKQYI
TPETKIVFSQTYRLLQYSVAAMVTSGTATLETALFGVPQVVCYYMSAGKLVSFLRKFLLK
VKYVSLVNLITGKETVKELVADGMTASNLKHEFAAILPGGDKRESVQDGYSQLKSILGNP
GASEKAAEIIVEALRSK

Enzyme Prediction     

No EC number prediction in MGYG000000042_02280.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	357	1.6e-107	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	6.74e-103	1	377	2	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.71e-96	1	375	2	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	9.09e-70	4	369	2	370	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.68e-64	5	372	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	3.68e-51	1	370	2	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO23865.1	2.78e-188	1	377	1	377
QUT77942.1	3.91e-181	1	375	1	377
ADY36062.1	4.43e-179	1	376	1	376
AII64873.1	2.43e-175	1	375	1	378
AND19645.1	2.43e-175	1	375	1	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	2.47e-38	5	372	11	379	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	2.47e-38	5	372	11	379	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	8.93e-67	5	375	8	379	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q1D393	1.18e-63	2	374	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q39T49	4.76e-63	2	377	8	383	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q74AT9	4.40e-60	2	374	8	380	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
B6J161	9.93e-60	5	370	8	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000042_02280.