CAZyme Information: MGYG000000043_00647

Basic Information

• Species: Phocaeicola sp900066455
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900066455
• CAZyme ID: MGYG000000043_00647
• CAZy Family: CBM9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
682		79655.69	5.6584

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000043	4183533	Isolate	United Kingdom	Europe

• Gene Location: Start: 18722; End: 20770 Strand: +

Full Sequence      

MRKQVIGSLFALLVVGQLWAQNLYTRYERMLTLPEGYVCYRTNGKIKIDGKLDEADWQKA
QPTSSFVDISGKGFAKPCYDTSAKMLWDDYYLYVAATLQEEDIKAKLSLRDTIIYYDNDF
EVFLDPDGDGQNYFEIETNAKGVMFDLMLDKPYRSGGNFLVQWDCPGLQLAVHREGTLNR
SDDKDKQWTVEMAIPHKALTVNFSNPAKAGNYWRINFSRVQWLKPGQREENWVWMPTGRI
DMHMPDRWGFLYLSDKVVGKGTDTFKYPYNLAAYKLLWAMFYAQLDYYAKEKNYLRAKEN
FFLTDAELQDLPVGSEISVEATSRTFCMSVTVPKEKIRYVVDQNGRFICEAITPRQVRNW
VWMRINKEKGDEFYKKHFALMKECGISGVMFEGYDENTYRVCKDAGLEAHYWKWTMNRKE
VLETHPDWFAVNRKGESCYDKPAYVDYYRFLCPNHEGVAEYLAADYLKEANLPYVDGVHL
DYVRFPDVVLPVSLWKNYGIEQTAELPEYDYCYCEVCRRMFKEQSGKDPLELKYPMEDQS
WINFRLDAITRVVDKITRTLKAEGKQISAAVFPGPSMARKMVRQDWGEWSLDAYFPMIYN
GFYYEGPEWIGRSVKESVQTVHGKAKIYAGLMFPDIKNTFEQALEEAFNNGASGVSFFDG
PDEEYLRKFKAYLDKRGFEVVK

Enzyme Prediction     

No EC number prediction in MGYG000000043_00647.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM9	48	251	8.7e-40	0.9835164835164835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09620	CBM9_like_3	4.96e-74	48	250	1	200	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily may co-occur with various other domains.
cd09618	CBM9_like_2	5.05e-31	37	220	2	170	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized subfamily are typically found at the N-terminus of longer proteins that lack additional annotation with domain footprints.
pfam06452	CBM9_1	6.62e-11	48	205	1	138	Carbohydrate family 9 binding domain-like. CBM9_1 is a C-terminal domain on bacterial xylanase proteins, and it is tandemly repeated in a number of family-members. The CBM9 module binds to amorphous and crystalline cellulose and a range of soluble di- and monosaccharides as well as to cello- and xylo- oligomers of different degrees of polymerization. Comparison of the glucose and cellobiose complexes during crystallisation reveals surprising differences in binding of these two substrates by CBM9-2. Cellobiose was found to bind in a distinct orientation from glucose, while still maintaining optimal stacking and electrostatic interactions with the reducing end sugar.
COG1649	YddW	2.33e-10	406	659	128	368	Uncharacterized lipoprotein YddW, UPF0748 family [Function unknown].
cd09619	CBM9_like_4	3.47e-08	48	249	4	187	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CUA18365.1	0.0	20	680	27	687
QRP90424.1	0.0	20	680	27	687
AKA51642.1	0.0	20	680	27	687
QCQ32632.1	0.0	20	680	26	686
BAD48606.1	0.0	20	680	27	687

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001962	0.997001	0.000300	0.000253	0.000235	0.000227

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000043_00647.