CAZyme Information: MGYG000000043_01764

Basic Information

• Species: Phocaeicola sp900066455
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900066455
• CAZyme ID: MGYG000000043_01764
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
272		31300.44	4.6165

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000043	4183533	Isolate	United Kingdom	Europe

• Gene Location: Start: 40840; End: 41658 Strand: +

Full Sequence      

MSAKKVLFITQEITPYVPESNLALIGQNLPQAIQDKGREIRTFMPKWGIVNERRNQLHEV
IRLSGMNLIIDDTDHPLIIKVASIQAARRQVYFIDNDDYFQHRQMTCDENGNDYEDNGER
AIFYARGVLETVKKLRWCPDVIHCHGWMSAMVPLYIKKAYYDEPSFRDSKVIFSLYEEGF
KSNLAPNFPEQLLFKEITSEDVSMMTSPVNYEELCKLAVAYSDGVIQNDKTVNQNVLDYA
RSLNVPVLEYSSADTYADACDAFYDKVFDAAE

Enzyme Prediction     

No EC number prediction in MGYG000000043_01764.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	5	226	6.5e-42	0.4449152542372881

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08323	Glyco_transf_5	2.69e-50	6	241	1	222	Starch synthase catalytic domain.
PRK14098	PRK14098	1.62e-46	5	214	7	223	starch synthase.
cd03791	GT5_Glycogen_synthase_DULL1-like	6.68e-35	5	241	1	221	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
COG0297	GlgA	8.27e-27	5	181	2	170	Glycogen synthase [Carbohydrate transport and metabolism].
PRK00654	glgA	2.66e-26	5	174	2	152	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO25341.1	8.56e-168	1	272	1	273
ADY34869.1	1.61e-167	1	272	1	273
AND20492.1	3.31e-151	1	268	1	269
QJR63829.1	4.70e-151	1	269	1	270
QJR68092.1	4.70e-151	1	269	1	270

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RZU_A	2.92e-08	6	184	3	175	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]
6GNE_A	7.46e-06	6	155	12	156	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
6GNG_A	7.97e-06	6	202	42	245	GranuleBound Starch Synthase I from Cyanophora paradoxa bound to acarbose and ADP [Cyanophora paradoxa],6GNG_B Granule Bound Starch Synthase I from Cyanophora paradoxa bound to acarbose and ADP [Cyanophora paradoxa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4SC83	5.14e-42	5	214	7	223	Glycogen synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) OX=324925 GN=glgA PE=3 SV=1
B3EGV0	5.22e-41	5	228	7	238	Glycogen synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330) OX=290315 GN=glgA PE=3 SV=1
Q3B6C3	5.22e-41	5	229	7	239	Glycogen synthase OS=Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530) OX=319225 GN=glgA PE=3 SV=1
A1BIY8	2.73e-40	5	214	7	223	Glycogen synthase OS=Chlorobium phaeobacteroides (strain DSM 266) OX=290317 GN=glgA PE=3 SV=1
Q3APL6	2.75e-39	5	214	7	223	Glycogen synthase OS=Chlorobium chlorochromatii (strain CaD3) OX=340177 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999170	0.000739	0.000078	0.000004	0.000002	0.000032

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000043_01764.