CAZyme Information: MGYG000000043_01781

Basic Information

• Species: Phocaeicola sp900066455
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900066455
• CAZyme ID: MGYG000000043_01781
• CAZy Family: GH88
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406	MGYG000000043_16|CGC2	46515.95	6.1871

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000043	4183533	Isolate	United Kingdom	Europe

• Gene Location: Start: 60739; End: 61959 Strand: -

Full Sequence      

MKIKHLFLGIGVMVFASCAVDKTKKLDVDKELTYCDMQIHRALSELEKDGEPDYTMEPRN
ILAGERFWNCKKVSREEWTGGFWPGILWYDYEATQNDTIRMLAEKYTESLELFSRIPAYD
HDLGFLVFCSYGNGYRLTHNPVYRDVIIATADSLATLFNPKVGTILSWPRNVKMLGGHNT
IMDNMINLEMLFWAARNGGDRRLFDMAVSHADKTMENQFRSDYSSYHVAVYDTVSGNCIK
KCTHQGYTDGSMWARGQAWAIYGYTVVFRETGNPKYLDFVEKVVDVYLKNLPEDYVPYWD
FNAPDIPDAPRDASAACVVASALLELSDFYGNGKGEKYKKVAEKMLCSLSSEKYQSREKN
VAFLLHSTGHWPAKSEVDASIIYADYYYIEALMRLKRLNEGKKAVE

Enzyme Prediction     

No EC number prediction in MGYG000000043_01781.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	72	395	8.8e-124	0.9908814589665653

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	7.93e-12	75	270	26	207	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG1331	YyaL	0.005	144	291	182	309	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR69439.1	1.84e-210	1	406	1	406
QJR65176.1	1.84e-210	1	406	1	406
QJR73772.1	1.84e-210	1	406	1	406
ALA72154.1	2.61e-210	1	406	1	406
QJR61010.1	2.61e-210	1	406	1	406

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	4.18e-85	56	403	54	393	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
1VD5_A	5.65e-56	59	397	15	366	CrystalStructure of Unsaturated Glucuronyl Hydrolase, Responsible for the Degradation of Glycosaminoglycan, from Bacillus sp. GL1 at 1.8 A Resolution [Bacillus sp. GL1],2D5J_A Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2D5J_B Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2FUZ_A UGL hexagonal crystal structure without glycine and DTT molecules [Bacillus sp. GL1]
2AHF_A	3.07e-55	59	397	15	366	ChainA, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHF_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_A Chain A, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1]
2ZZR_A	1.56e-52	71	394	61	388	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	1.59e-52	71	394	62	389	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	1.94e-91	72	398	71	397	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q9RC92	3.10e-55	59	397	15	366	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
Q8DR77	1.04e-53	73	394	62	387	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q9A0T3	4.30e-53	73	394	65	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q8E372	8.72e-52	71	394	62	389	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000271	0.158905	0.840622	0.000061	0.000071	0.000062

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000043_01781.