CAZyme Information: MGYG000000043_02051

Basic Information

• Species: Phocaeicola sp900066455
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900066455
• CAZyme ID: MGYG000000043_02051
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
801	MGYG000000043_21|CGC1	90954.58	6.3379

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000043	4183533	Isolate	United Kingdom	Europe

• Gene Location: Start: 35060; End: 37465 Strand: -

Full Sequence      

MKVGMMKRNLIAGCLCLMMWNGISSNIQAQDRLYRNTFPLGDVELLDGPFKHAQELNLKV
LMEYDVDRLLAPFLKEAGLPVKAEPFPNWAGLDGHVGGHYLSAMAMNYAATGNEECKKRM
EYMLSELKRCQESNGDGYIGGIPNGKVLWTDIKNGKVESIWKYWAPWYNVHKIFAGLRDA
WMYTGNQEALGMFLKLCDWGISVTEGLSDNQMEQMLANEFGGMDEIFADAYQITGEQKYL
TTAKRFSHRWLFDSMAAHKDNLDNIHANTQIPKVIGYQRIAEVCGDNQYLDAADFFWNIV
ACKRSLALGGNSRREYFSAMDDFRSHVEVREGPESCNTYNMLKLTEGLFRMTGKATYTDF
YERALYNHILSTQHPEHGGYVYFTSARPAHYRVYSKPNSAMWCCVGTGMENHGKYGEFIY
THASDSLFVNLFIPSRLNWEQEKVTITQETQFPDAETSRFTVGLKGGKSRHFKLLVRRPA
WVTEGYEVKCNGKVVEASEKTDGSSYICIDRKWKDGDKVEVFLPMKMRLETLQGEDDFVA
IMRGPILMGASVGTDNLDGLVADDGRWGHIASGKLVPLSETPVLIGSKEEVTDYLNGLKP
MEGQTLRYKLSGIFNDSKFDGLVLEPFSRIHDCRYMMYWLCMTADGYAAYTKRTQEEEKR
LMALDARTLDAVSVGEQQPEVDHKMVKENSETGLLKGKKWRDARNGGYFKYTLSTNGKQP
SSLMATYWGNEQGNRNFEIVVDGTVVATENIVGKWNKEEFVDVEYKLPEALVKGKNQIEV
MFRSKDNNVAGGIFMLRLLTE

Enzyme Prediction     

EC	3.2.1.185

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	42	548	4.2e-204	0.9960238568588469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	4.41e-179	42	547	1	501	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	4.16e-110	43	555	12	507	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	4.69e-39	553	639	1	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36520.1	0.0	25	799	18	785
ADY37333.1	0.0	6	801	1	797
SCV06553.1	0.0	5	801	1	798
QRQ58640.1	0.0	5	801	1	798
ALJ47143.1	0.0	5	801	1	798

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	4.18e-229	28	799	18	801	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	8.05e-221	28	799	18	801	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	7.98e-26	113	547	88	543	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	1.76e-16	100	547	82	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	2.13e-15	100	547	82	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001192	0.997178	0.000940	0.000258	0.000216	0.000195

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000043_02051.