CAZyme Information: MGYG000000043_02054

Basic Information

• Species: Phocaeicola sp900066455
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900066455
• CAZyme ID: MGYG000000043_02054
• CAZy Family: CE1
• CAZyme Description: Endo-1,4-beta-xylanase Z

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
290	MGYG000000043_21|CGC1	33143.97	6.159

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000043	4183533	Isolate	United Kingdom	Europe

• Gene Location: Start: 41585; End: 42457 Strand: -

Full Sequence      

MNKHVFIVILSVLGLIPVSLFSRSRVVNDTIFSKKLNTERVCSIYLPPSYGEVPGKKYPV
LYLFHGMSQTNQDWVWRGHVQEVADRLIYAQEASEMIIVMPDAGGDIYKEVWNGFFNMPG
WLYEDFFFEEFLPHVESKYNIIGDKENRAVAGLSMGGGGATGYGLWHADKFASVYAMSAL
MSIPEEGAARFENPNSKLAILTRAVIDRSCIKRVAEAEENTVQALKSVRWFIDCGDDDFL
LDRNIEFFQAMRKAGIPCQFRVRDGGHDWEYWHSALYMCLPFVSRTFDKR

Enzyme Prediction     

No EC number prediction in MGYG000000043_02054.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	33	284	6.2e-57	0.9823788546255506

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	8.89e-30	21	276	63	288	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	5.69e-24	33	276	1	239	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG0627	FrmB	4.48e-21	43	289	38	314	S-formylglutathione hydrolase FrmB [Defense mechanisms].
PLN02442	PLN02442	3.68e-07	18	278	5	270	S-formylglutathione hydrolase
COG2819	YbbA	5.84e-05	33	178	16	169	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEK50415.1	5.75e-32	29	289	44	281
ADQ79787.1	2.45e-31	32	281	145	379
ABQ06889.1	2.68e-31	33	288	314	544
ALR29593.1	6.16e-31	30	290	47	281
VTS04162.1	8.99e-31	33	285	68	293

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VOL_A	9.84e-136	23	289	9	274	Bacint_04212ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_B Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_C Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_D Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_E Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_F Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_G Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_H Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393]
1JJF_A	3.30e-26	23	286	29	260	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	8.90e-26	23	286	29	260	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]
4RGY_A	2.83e-17	56	283	41	261	Structuraland functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12],4RGY_B Structural and functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12]
6RZN_A	3.42e-17	33	285	139	386	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10478	5.26e-24	23	286	48	279	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EXZ4	1.25e-17	32	285	437	670	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P23553	5.17e-16	52	288	35	266	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1
P31471	2.20e-15	30	211	147	342	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
P9WM38	8.24e-13	43	267	191	425	Esterase MT1326 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1326 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.040414	0.958035	0.000732	0.000293	0.000234	0.000250

TMHMM  Annotations     

start	end
5	27