CAZyme Information: MGYG000000043_02166

Basic Information

• Species: Phocaeicola sp900066455
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900066455
• CAZyme ID: MGYG000000043_02166
• CAZy Family: GH97
• CAZyme Description: Retaining alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
642	MGYG000000043_23|CGC2	73488.95	6.0606

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000043	4183533	Isolate	United Kingdom	Europe

• Gene Location: Start: 49809; End: 51737 Strand: +

Full Sequence      

MRKTLFFLLLASSAAMFAENYTVKSPDERILVNVETGATTTYSVTFNGKTILNPSPLSMT
FDNGVVIGRNMKVKDVQHRTEDQMLTPVVRQKSDKIRDHYNEMVLNADQYKLYFRVYNDG
LAYRFHTDFADSLKVISEEVDYCFPEDYNTLFPEERTILSAQQPLFKPMKLSEIGTDRFC
STPVLIKVDDQARIFISESDLESYPGMFLKKQGKYELAGKFAAYSLEEEKTDDRQIFPTK
RADYIARVSGTRNYPWRAMIVAENDANLVTNQLIYKLAPESQGDFSWVKPGKIAWDWYNA
LILTGVDFKCGINNETYKYYIDFASKYGLEYVVLDDGWSEAWDVTKTVPEIDMEELVAYG
KKKNVGLILWVSWAPFREKLDEAFALFSKWGIKGIKMDFMNRDDQAMVDFYYTVARKAAA
HRMLVDFHGAYKPTGWLRTFPNVLSSEGVAGLENHKWGSFVTPEHNVTLPFTRMVAGPMD
YTPGAMINFHEKDHKVWFNLPASIGTRCHQLGMYVVYESPLQMLADSPSNYYREEKCMEF
LSQVPVVWDETRVLKASVGEYIVVARRSGDTWFIGGMVGKKGQKFDITLDFIKGNKTLTC
WEDGVNVDLQAQDFACRTKKVKQGDTITISMYDGGGYVAIIK

Enzyme Prediction     

EC	3.2.1.22

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	9	641	2.3e-207	0.993660855784469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	8.51e-143	284	545	1	278	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	4.02e-63	25	279	1	234	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	2.92e-35	548	642	1	97	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.
cd14791	GH36	2.83e-04	321	403	25	155	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEW37779.1	0.0	1	642	1	642
QIM10885.1	0.0	59	642	1	584
QGY44374.1	1.03e-238	1	641	1	645
QIA06743.1	2.14e-233	7	642	8	647
AHW59714.1	1.61e-230	4	642	5	647

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3A24_A	6.00e-169	25	642	6	641	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]
5E1Q_A	1.06e-167	25	642	20	655	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
5HQ4_A	3.80e-69	22	636	2	653	AGlycoside Hydrolase Family 97 enzyme from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8],5HQA_A A Glycoside Hydrolase Family 97 enzyme in complex with Acarbose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQC_A	3.80e-69	22	636	2	653	AGlycoside Hydrolase Family 97 enzyme R171K variant from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQB_A	1.02e-68	22	636	2	653	AGlycoside Hydrolase Family 97 enzyme (E480Q) in complex with Panose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A6L0	2.51e-170	1	642	1	662	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
D7CFN7	7.74e-69	26	640	46	619	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1
G8JZS4	6.35e-65	1	642	1	724	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000321	0.998997	0.000174	0.000176	0.000158	0.000145

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000043_02166.