CAZyme Information: MGYG000000043_02652

Basic Information

• Species: Phocaeicola sp900066455
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900066455
• CAZyme ID: MGYG000000043_02652
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
769	MGYG000000043_36|CGC1	89157.12	6.8278

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000043	4183533	Isolate	United Kingdom	Europe

• Gene Location: Start: 10461; End: 12770 Strand: -

Full Sequence      

MKQVCKFLLACALGIWSGSAGAKDSEAGQVRKMIDKVNQHWQAENSPEVRSFWDNAVYHT
GNMEAYFLTGNETYRTYSETWANYNQWKGAKSDNRSEWKYSYGESDEYVLFGDYQICFQT
YVDLYNLAPEDWKIRRAREVMEYQMSTSQNDYWWWSDALYMAMPVMTKLYKVTHNTLYLD
KLYAYLQYSDSIMFDKDENLYYRDAKYIYPKHKTASGKKDFWARGDAWVLAGLAKVLKDM
PEEYKHHSFFVEKFQKMAKAVAAIQQPEGYWTRSMMDPDFAPGPETSGTALFTYGFLWGI
NNGYLGKDTYMPVVEKAWSYLSKRALQKDGTVGYVQPIGEKAIPGQVINANSTANFGVGA
FLLAACEYVRYLEAPQAADRVYWCKLAYQMAAPVLRNMAKGELQKNMQLEVSPTWDGRNK
KVAYMETFGRLMAGIAPWLTLPDDNTEEGKMRKELREWALKSYANAVDPQSPDYLLWRQE
GQTLVDGAYVAESFLRAYDQLWMPLDETTKKRYIEEFQQLRRIDPPYTNWLLFSSTIESF
LAKAGAPFDEYRVNSAIRKVEEWYTGDGWYSDGPSFAFDYYSSYVFHPMYLETLQAMKDA
KVRSRIDYGKYYDRALKRAQKYSLILERFISPEGTFPVFGRSIPYRMATMQPLALMAWYQ
ELPAGVTGAQVRCALTAVMKRMFATGHNFNEGGFLTIGFTGRQPNVADWYTNNGSLYMTS
LAFLPLGLPASHPFWTDAPQEWTSVRAWGEKPFPKDHQWKDEIRTWDLF

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH154	379	740	8.2e-107	0.9942528735632183
GH105	44	370	5.5e-75	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10022	DUF2264	5.34e-159	379	742	1	351	Uncharacterized protein conserved in bacteria (DUF2264). Members of this family of hypothetical bacterial proteins have no known function.
pfam07470	Glyco_hydro_88	1.82e-91	30	372	6	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4289	COG4289	1.38e-70	419	743	50	368	Uncharacterized protein [Function unknown].
COG4225	YesR	1.65e-35	53	370	36	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY36172.1	0.0	1	769	1	770
QEW35177.1	0.0	1	769	1	771
AND21736.1	0.0	1	769	1	771
AII65647.1	0.0	1	769	1	771
QQY40390.1	0.0	1	769	1	771

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	1.27e-185	8	373	13	376	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	2.64e-165	29	373	15	359	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	3.25e-52	53	370	53	368	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	4.78e-12	37	367	25	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.88e-11	37	367	15	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	2.12e-51	53	370	60	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	1.44e-50	53	373	58	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	3.51e-39	153	367	199	407	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	2.61e-11	37	367	25	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001017	0.992460	0.005730	0.000291	0.000242	0.000226

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000043_02652.